DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and CG6763

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:233 Identity:91/233 - (39%)
Similarity:130/233 - (55%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTG 92
            :|||.|.::||||::   .|.:|..     :|||.....|||..||.|.|..:|:......|:..
  Fly    85 NPEELGSYLEGDMLV---PQTDLIM-----KNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENA 141

  Fly    93 IDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCF-RPGTILH 156
            |......||:||.:.:.| :.|:::...:.||:::||..|..||:||:    ..||. ||||.:|
  Fly   142 IGEYHRRTCIRFVKRSSE-RDYISIRGDNSGCWSSVGRVGGKQEVNLQ----SPGCLSRPGTAMH 201

  Fly   157 EFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFS 221
            |.||||||.|:|:...||.::.:.|.|:......||:|.|.|..  |.|.|||.|.:||...|||
  Fly   202 ELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEA--FGVPYDYGSVMHYSKNAFS 264

  Fly   222 INGEDTIVPLDSSAV--IGQRVGLSSKDIDKINIMYKC 257
            |||:.||:.:.::..  :|||.|.|..||.|:|.||.|
  Fly   265 INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 78/195 (40%)
ZnMc_astacin_like 70..255 CDD:239807 72/187 (39%)
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 78/194 (40%)
ZnMc_astacin_like 119..300 CDD:239807 72/187 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444928
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm44135
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
87.850

Return to query results.
Submit another query.