DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and MEP1A

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_011512930.1 Gene:MEP1A / 4224 HGNCID:7015 Length:774 Species:Homo sapiens


Alignment Length:271 Identity:85/271 - (31%)
Similarity:142/271 - (52%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IYVLLLQVVLNSGKPLP-AGVYDPE------------EAG-GFVEGDMMLTEEQQRNLEQGAPKA 57
            :|:...|:     |.|| ..|:|.:            .|| ...:||::|            .|:
Human    45 LYIYFFQI-----KYLPEENVHDADFGEQKDISEINLAAGLDLFQGDILL------------QKS 92

  Fly    58 RNGLINTEKRW--PGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAK 120
            ||||.:...||  |   :.|.::|:.....|.||....:...|.:|:.|:....| .:|: :..:
Human    93 RNGLRDPNTRWTFP---IPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGE-SSYI-IFQQ 152

  Fly   121 SGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIV 185
            ..||::.||.|...|.::     :|:||.....|.||.:|||||||:||.:.|||::|:.::.|:
Human   153 FDGCWSEVGDQHVGQNIS-----IGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDQIL 212

  Fly   186 PGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE-DTI---VPLDSSAVIGQRVGLSSK 246
            .|.:.||..|.|:::||....|||:|.:||:|.:|:.|.. .||   :| :.:::||||:..|:.
Human   213 SGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIP-EFNSIIGQRLDFSAI 276

  Fly   247 DIDKINIMYKC 257
            |::::|.||.|
Human   277 DLERLNRMYNC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 68/198 (34%)
ZnMc_astacin_like 70..255 CDD:239807 62/188 (33%)
MEP1AXP_011512930.1 ZnMc_meprin 58..287 CDD:239809 79/251 (31%)
Astacin 101..289 CDD:279708 68/198 (34%)
MAM 292..459 CDD:214533
MAM 297..459 CDD:99706
MATH_Meprin_Alpha 459..622 CDD:239752
EGF_CA 700..738 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8634
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.