DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and CG6974

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster


Alignment Length:273 Identity:90/273 - (32%)
Similarity:127/273 - (46%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSGIIYVLLLQVVLNSGKPLPAGVYDPE-EAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINT 64
            |....:.|:||            ||::.|. .|...:|.......|...:.||...|.||.|.:.
  Fly     1 MFLKAVRYLLL------------AGIFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALTSP 53

  Fly    65 EKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFRE---ATDEDKAYLTVTAKSGGCYT 126
            .:|||||.::||||.|:.......::|.:.:....||::|.|   |....|.|::.......|.|
  Fly    54 LQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGT 118

  Fly   127 AVGYQG---APQEMNLEIYPLGEGCF-RPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPG 187
            .||||.   .|.|:     .|.|.|. .|..|.||.:|.||.:|:||...||:::.:.|:|| |.
  Fly   119 RVGYQPLSFGPHEV-----VLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNI-PR 177

  Fly   188 KEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVP-----LDSSAV---IGQRVGLS 244
            |.:: |..|....|.|.|.|||:|.:||...||:   :|...|     :...||   :||..|.|
  Fly   178 KYWS-QFMAMDQTTTFNVPYDYESVMHYSKNAFA---KDPSKPTIRALIGGKAVEREMGQVRGPS 238

  Fly   245 SKDIDKINIMYKC 257
            ..|..||.:||||
  Fly   239 EGDWTKIRLMYKC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 74/207 (36%)
ZnMc_astacin_like 70..255 CDD:239807 67/199 (34%)
CG6974NP_650414.1 Astacin 55..251 CDD:279708 72/205 (35%)
ZnMc_astacin_like 59..249 CDD:239807 67/199 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122071at6656
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.