DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15255 and CG42255

DIOPT Version :9

Sequence 1:	NP_001285958.1	Gene:	CG15255 / 34913	FlyBaseID:	FBgn0028950	Length:	261	Species:	Drosophila melanogaster
Sequence 2:	NP_729748.3	Gene:	CG42255 / 39334	FlyBaseID:	FBgn0259140	Length:	3613	Species:	Drosophila melanogaster

Alignment Length:	131	Identity:	33/131 - (25%)
Similarity:	49/131 - (37%)	Gaps:	38/131 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    59 NGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGG 123
            ||.|....:..||.|:.|    :|..|...                 :.||....|.|      .
  Fly  1257 NGTIAKPLQSTGNRVLVR----YDVGHDAP-----------------DGTDFMLNYQT------N 1294

  Fly   124 CYTAV-GYQGAPQEMNL-EIYPLGEGC---FRPGTILHEFMHALGFYH---QQSSSI-RDDFINV 179
            |...: |.|||.:..|. |.||.|:.|   .|.|...:...  |.|.|   ::.||| .:|::::
  Fly  1295 CRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQ--LIFSHLSVEKFSSICLNDYVSL 1357

  Fly   180 I 180
            :
  Fly  1358 V 1358

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15255	NP_001285958.1	Astacin	66..258	CDD:279708	30/124 (24%)
CG15255	NP_001285958.1	ZnMc_astacin_like	70..255	CDD:239807	30/120 (25%)
CG42255	NP_729748.3	EGF_CA	156..190	CDD:238011
		EGF_CA	192..233	CDD:238011
		EGF_CA	290..328	CDD:214542
		EGF_CA	330..374	CDD:214542
		EGF	427..455	CDD:278437
		EGF_CA	462..496	CDD:238011
		CUB	503..619	CDD:238001
		CUB	624..738	CDD:238001
		CUB	745..854	CDD:238001
		CUB	857..963	CDD:238001
		CUB	1066..1179	CDD:238001
		CUB	1185..1293	CDD:238001	12/56 (21%)
		CUB	1303..1406	CDD:238001	18/58 (31%)
		CUB	1411..1523	CDD:238001
		CUB	1530..1648	CDD:238001
		CUB	1754..1862	CDD:238001
		CUB	1979..2091	CDD:238001
		CUB	2096..2193	CDD:294042
		CUB	2210..2321	CDD:238001
		CUB	2327..2441	CDD:238001
		CUB	2688..2782	CDD:294042
		CUB	2810..2911	CDD:238001
		CUB	3029..3143	CDD:238001
		CUB	3169..3249	CDD:294042
		CUB	3499..3607	CDD:238001
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45444852
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3714
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.830