DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Tll2

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001178827.1 Gene:Tll2 / 365460 RGDID:1559756 Length:1014 Species:Rattus norvegicus


Alignment Length:202 Identity:75/202 - (37%)
Similarity:112/202 - (55%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAV 128
            ||:.|||.|:.|.|..:|....:...:..:...|.|||:.|.|.|||: :::..:.::.||.:.|
  Rat   154 TERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFIERTDEE-SFIVFSYRTCGCCSYV 217

  Fly   129 GYQ-GAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNF 192
            |.: |.||.::     :|:.|.:.|.:.||..|.:||:|:.:...||..:.:|.|||.||:|:||
  Rat   218 GRRGGGPQAIS-----IGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNF 277

  Fly   193 QKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE--DTIVP-LDSSAV---IGQRVGLSSKDIDKI 251
            .|.....|:.....||:||.:||....|| .|.  |||:| .|.:.|   |||||.||..||.:.
  Rat   278 LKMEAGEVSSLGETYDFDSIMHYARNTFS-RGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQA 341

  Fly   252 NIMYKCP 258
            ..:||||
  Rat   342 RKLYKCP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 71/198 (36%)
ZnMc_astacin_like 70..255 CDD:239807 67/191 (35%)
Tll2NP_001178827.1 ZnMc_BMP1_TLD 149..348 CDD:239808 73/200 (37%)
Astacin 156..349 CDD:279708 73/200 (37%)
CUB 350..459 CDD:278839
CUB 463..572 CDD:278839
FXa_inhibition 583..615 CDD:291342
CUB 619..728 CDD:278839
FXa_inhibition 735..770 CDD:291342
CUB 775..884 CDD:278839
CUB 888..1001 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.