DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-23

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001022281.1 Gene:nas-23 / 3565992 WormBaseID:WBGene00003542 Length:537 Species:Caenorhabditis elegans


Alignment Length:243 Identity:73/243 - (30%)
Similarity:114/243 - (46%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRN-----LEQGAPKA---RNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGI 93
            :||:.|:.|...|     |:....|.   ||.:. .:..|..| |.:.:........:.::...:
 Worm    86 QGDIHLSFEHLSNIVREQLDHSRTKRTAFRNAMY-PKTIWLPN-VPFELHGSLSAKSRSSLVAAM 148

  Fly    94 DTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVG---YQGAPQEMNLEIYPLGEGCFRPGTIL 155
            ...|.|||:.|::.|.| |.||.::.:..||::.||   .|||      :|..:|.||...|...
 Worm   149 AFWEKHTCVAFKKRTSE-KVYLLMSGQEEGCWSTVGRDEAQGA------QILNIGTGCEMFGITS 206

  Fly   156 HEFMHALGFYHQQSSSIRDDFINVI---------YENIVPGKEFNFQKYADTVVTDFEVGYDYDS 211
            ||..||||.:|:||...||:::.::         |:..|.||: |.:.|...        ||..|
 Worm   207 HEIAHALGLFHEQSRYDRDNYVQIVKSRIAQTNFYDFAVVGKK-NMETYGQK--------YDIGS 262

  Fly   212 CLHYRPGAFSINGEDTIVPLDSSA--VIGQRVGLSSKDIDKINIMYKC 257
            .:||||..||::|.::|:..|.:.  .:||..|.|..|:.|||..|.|
 Worm   263 VMHYRPTEFSLDGGNSIIAKDVNMQNTMGQFRGPSFIDVAKINRHYNC 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 64/206 (31%)
ZnMc_astacin_like 70..255 CDD:239807 61/198 (31%)
nas-23NP_001022281.1 Astacin 122..310 CDD:279708 63/204 (31%)
ZnMc_astacin_like 128..308 CDD:239807 60/195 (31%)
CUB 384..454 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.