DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and CG15254

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster


Alignment Length:233 Identity:114/233 - (48%)
Similarity:152/233 - (65%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTG 92
            |||...|::||||:           .:|:.||||.|...|||..:|.|.|:.|.||.|:..|..|
  Fly    30 DPELTAGYIEGDMV-----------PSPEGRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRG 83

  Fly    93 IDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHE 157
            |..:|..:||.|:|||.:.:.|:.||:::||||:.|||:...|::||:.|.|..||||.|||:||
  Fly    84 IRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHE 148

  Fly   158 FMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSI 222
            |:||||||||||:..|||::.:..|||..|.|.||.||.:..|.|:...|||.|.|||...|||.
  Fly   149 FLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSK 213

  Fly   223 NGEDTIVPLDSSA--VIGQRVGLSSKDIDKINIMYKCP 258
            |||.|||||...|  ::|||:.::..||:|:|:|||||
  Fly   214 NGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKCP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 98/193 (51%)
ZnMc_astacin_like 70..255 CDD:239807 92/186 (49%)
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 98/192 (51%)
ZnMc_astacin_like 61..248 CDD:239807 92/186 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444926
Domainoid 1 1.000 202 1.000 Domainoid score I6324
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.