DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Semp1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:237 Identity:104/237 - (43%)
Similarity:140/237 - (59%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPEEAGGFVEGDMMLTEEQQRNLEQGAP-KARNGLINTEKRWPGNVVVYRISDD-FDTAHKKAIQ 90
            |||...||.:||:           :..| :.|||::|....||...|.|.|.|| |..:|.:.|.
  Fly    23 DPELLAGFYQGDI-----------KAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREIL 76

  Fly    91 TGIDTLELHTCLRFREATDED-KAYLTVTAKSGGCYTA-VGYQGAPQEMNLEIYPLGEGCFRPGT 153
            ..|..:|.::|:.|:.||:.| ...|.:|:|..||.|. :||:...|.:|||||||||||||.|:
  Fly    77 RAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGS 141

  Fly   154 ILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNF-QKYADTVVTDFEVGYDYDSCLHYRP 217
            |:||.:|.|||.||..|..||.::::.::||.|....|| .....|...||:.||||:|.:||.|
  Fly   142 IIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVP 206

  Fly   218 GAFSINGEDTIVPLDSSAV-IGQRVGLSSKDIDKINIMYKCP 258
            .|||.||:.|||||...|. :|||..:|.|||.|:|.||:||
  Fly   207 RAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRCP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 90/196 (46%)
ZnMc_astacin_like 70..255 CDD:239807 86/189 (46%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 92/196 (47%)
ZnMc_astacin_like 55..245 CDD:239807 86/189 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444825
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.