DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and mep1bb

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_009294699.1 Gene:mep1bb / 327586 ZFINID:ZDB-GENE-030131-5797 Length:774 Species:Danio rerio


Alignment Length:276 Identity:94/276 - (34%)
Similarity:139/276 - (50%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IIYVL------------LLQVVLNS-------GKPLPAGVYDPEEAGG--FVEGDMMLTEEQQRN 49
            ::|:|            |::.|.:|       ||   ..::|..|..|  ..|||::..|     
Zfish    13 LVYLLLFVSARCEVTQRLIECVTSSTEYNVDGGK---EDLFDVNEDAGLDLFEGDILYDE----- 69

  Fly    50 LEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAY 114
                 ...||.:|..|.||| ..:.|...||.:...|..|....:...|.||:.::..|.|:. |
Zfish    70 -----TLGRNSIIGEEYRWP-KTIPYYFEDDLEINAKGVILKAFEQYRLKTCIDYKPWTGEEN-Y 127

  Fly   115 LTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINV 179
            ::| .|..||:::||    .:.:..:...:|.||.|..||.|||:|||||:|:||.|.|||::::
Zfish   128 ISV-FKGNGCFSSVG----NRRVGRQTLSIGSGCDRIATIEHEFLHALGFWHEQSRSDRDDYVSI 187

  Fly   180 IYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTI---VPLDSSAVIGQRV 241
            :::.|..|||.||.||.|:..:...|.|||.|.:||...||....|.||   :|..|| |||||:
Zfish   188 MWDRITEGKEHNFNKYNDSSSSALNVPYDYSSMMHYSQKAFQSGSEPTIITRIPAFSS-VIGQRM 251

  Fly   242 GLSSKDIDKINIMYKC 257
            ..|..|:.|:|.:|.|
Zfish   252 EFSDSDLLKLNRLYNC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 76/195 (39%)
ZnMc_astacin_like 70..255 CDD:239807 71/187 (38%)
mep1bbXP_009294699.1 ZnMc 39..267 CDD:294052 88/248 (35%)
Astacin 81..269 CDD:279708 76/195 (39%)
MAM 277..441 CDD:279023
MAM 277..440 CDD:99706
MATH 440..608 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.