DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Astl

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:253 Identity:82/253 - (32%)
Similarity:127/253 - (50%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LNSGKPLPA---GVYDPE--EAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNV--- 72
            ::..|.:||   |:...|  |:...||||::            .|.....|..|..:||..|   
  Rat    49 VSQDKDIPAINQGLISEETPESSFLVEGDII------------RPSPFRLLSVTNNKWPKGVDGI 101

  Fly    73 --VVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQ 135
              :.:.:|..:|...::.|.......|..||:|| .|....:.::::...: ||::.||..|..|
  Rat   102 VEIPFLLSSKYDEPSRQVIMEAFAEFERFTCIRF-VAYRGQRDFVSILPMA-GCFSGVGRSGGMQ 164

  Fly   136 EMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVV 200
            .::|....|.:|   .|.:|||.||.|||:|:.|.:.||.:|.|.:..|:||.|.||.|..:   
  Rat   165 VVSLAPTCLQKG---RGIVLHELMHVLGFWHEHSRADRDRYIRVNWNEILPGFEINFIKSRN--- 223

  Fly   201 TDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSAV-IGQRVGLSSKDIDKINIMYKC 257
            ::....|||.|.:||...|||..|:.||:||.:|:| ||||..||:.||.::..:|.|
  Rat   224 SNMLAPYDYSSVMHYGRFAFSWRGQPTIIPLWTSSVHIGQRWNLSTSDITRVCRLYSC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 69/198 (35%)
ZnMc_astacin_like 70..255 CDD:239807 65/190 (34%)
AstlNP_001099974.1 Astacin 92..283 CDD:279708 69/198 (35%)
ZnMc 99..281 CDD:294052 65/189 (34%)
ImpA_N <305..420 CDD:303075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.