DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Mep1b

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:258 Identity:87/258 - (33%)
Similarity:136/258 - (52%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YVLLLQVVLNSGKPLPAGVYDPEEAGGFVEGDMM-LTEEQQRNLEQGAPK----ARNGLINTEKR 67
            :::....:|.||.|.|....  ::..|.::.|:. :.|:...:|.:|..|    .||.:|....|
  Rat     9 FLVFATFLLVSGLPAPEKFV--KDIDGGIDQDIFDINEDLGLDLFEGDIKLEASGRNSIIGDNYR 71

  Fly    68 WPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVG-YQ 131
            || :.:.|.:.|..:...|..|....:...|.||:.|:..:.|:. |::| .|..||:::|| ..
  Rat    72 WP-HTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWSGEEN-YISV-FKGSGCWSSVGNIH 133

  Fly   132 GAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYA 196
            ...||::     :|..|.|..|:.|||:|||||:|:||.:.|||:|.::::.|:.|||.||..|.
  Rat   134 AGKQELS-----IGTNCDRIATVQHEFLHALGFWHEQSRADRDDYITIVWDRILSGKEHNFNIYN 193

  Fly   197 DTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVP--LDSSAVIGQRVGLSSKDIDKINIMYKC 257
            |:|.....|.|||.|.:||...||....|.||:.  .|...|||||:..|..|:.|:|.:|.|
  Rat   194 DSVSDSLNVPYDYTSVMHYSKTAFQNGTESTIITKISDFEDVIGQRMDFSDYDLLKLNQLYSC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 73/195 (37%)
ZnMc_astacin_like 70..255 CDD:239807 68/187 (36%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 81/233 (35%)
Astacin 70..258 CDD:279708 73/195 (37%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.