DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Tll2

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_036034.1 Gene:Tll2 / 24087 MGIID:1346044 Length:1012 Species:Mus musculus


Alignment Length:202 Identity:75/202 - (37%)
Similarity:112/202 - (55%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAV 128
            ||:.|||.|:.|.|..:|....:...:..:...|.|||:.|.|.|||: :::..:.::.||.:.|
Mouse   152 TERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFVERTDEE-SFIVFSYRTCGCCSYV 215

  Fly   129 GYQ-GAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNF 192
            |.: |.||.::     :|:.|.:.|.:.||..|.:||:|:.:...||..:.:|.|||.||:|:||
Mouse   216 GRRGGGPQAIS-----IGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNF 275

  Fly   193 QKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE--DTIVP-LDSSAV---IGQRVGLSSKDIDKI 251
            .|.....|:.....||:||.:||....|| .|.  |||:| .|.:.|   |||||.||..||.:.
Mouse   276 LKMEAGEVSSLGETYDFDSIMHYARNTFS-RGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQA 339

  Fly   252 NIMYKCP 258
            ..:||||
Mouse   340 RKLYKCP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 71/198 (36%)
ZnMc_astacin_like 70..255 CDD:239807 67/191 (35%)
Tll2NP_036034.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..135
ZnMc_BMP1_TLD 147..346 CDD:239808 73/200 (37%)
Astacin 154..347 CDD:279708 73/200 (37%)
CUB 348..457 CDD:278839
CUB 461..570 CDD:278839
FXa_inhibition 581..613 CDD:291342
CUB 617..726 CDD:278839
FXa_inhibition 733..768 CDD:291342
CUB 773..882 CDD:278839
CUB 886..999 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.