DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-30

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_490795.5 Gene:nas-30 / 190803 WormBaseID:WBGene00003548 Length:741 Species:Caenorhabditis elegans


Alignment Length:239 Identity:80/239 - (33%)
Similarity:123/239 - (51%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRNLEQGAPKARNG--------LINTEKRWPGNVVVYRISDDFDTAHKKAIQTGI 93
            |.||:||.:|.:.:...|.:|||.        :..:..||. :|:.:|.... |...||.|:.|:
 Worm   294 ESDMVLTVKQMKAIVLAAQEARNPHGRKKRKVITGSVYRWK-SVIPFRFKGG-DAKWKKLIREGL 356

  Fly    94 DTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEF 158
            ...|..||:|:.| ....|.|: :..:..|||::||..|..|     :..:|.||...|.:.||.
 Worm   357 GLWEKETCVRWSE-NGPGKDYV-IFFRGSGCYSSVGRTGGSQ-----LISIGYGCEDKGIVAHEV 414

  Fly   159 MHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSIN 223
            .|:|||:|:||...|||:|::..:.|:.|.:.||:|.:...:.|..|.||..|.:||...||:.:
 Worm   415 GHSLGFWHEQSRPDRDDYIHLRKDWIIKGTDGNFEKRSWEEIEDMGVPYDVGSVMHYGSNAFTKD 479

  Fly   224 GED-TIVPLDS--SAVIGQRVGLSSKDIDKINIMY---KCPILL 261
            .:. ||...||  ...||||..||..|:.::|.:|   .||:.|
 Worm   480 WDQITIETKDSRYQGTIGQRQKLSFIDVKQVNRLYCNSVCPVAL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 67/197 (34%)
ZnMc_astacin_like 70..255 CDD:239807 64/187 (34%)
nas-30NP_490795.5 ZnMc_astacin_like 336..514 CDD:239807 64/185 (35%)
CUB 564..648 CDD:412131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.