DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-21

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_505907.2 Gene:nas-21 / 188422 WormBaseID:WBGene00003540 Length:380 Species:Caenorhabditis elegans


Alignment Length:221 Identity:50/221 - (22%)
Similarity:92/221 - (41%) Gaps:32/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDD-FDTAHKKAIQTGIDTLELHTCLRFREATD 109
            :.:.||:...:|..  ::.|.|||...:.|...:. ||...:..:...::.:..|||::|   :.
 Worm    36 ETKRLERSKRQALR--MDNEPRWPRGTINYFFDEQRFDENSRATVLRAMEKISNHTCIKF---SP 95

  Fly   110 EDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRD 174
            :|...........||..|:|..|..|    :.......|:..|: ..|.:|.:||.|....:.||
 Worm    96 KDARIKLRIVSDKGCQAAIGRVGGDQ----QYLSFPTSCYSVGS-ASELIHVIGFLHSHQRADRD 155

  Fly   175 DFINVIYENIVPGK------EFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDS 233
            :::.:   |:.|.:      ...::||.|..   :.|.|||.|.:.|.      :.::...|.:|
 Worm   156 EYLKL---NLQPWRLNDWFQTMQYKKYLDQW---WIVPYDYGSIMQYH------DSDNEYGPKNS 208

  Fly   234 S--AVIGQRVGLSSKDIDKINIMYKC 257
            .  ..:|.::. |..|...||..|:|
 Worm   209 KYFRTMGSQIP-SYFDYLMINEYYQC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 46/201 (23%)
ZnMc_astacin_like 70..255 CDD:239807 41/193 (21%)
nas-21NP_505907.2 ZnMc 52..192 CDD:214576 36/153 (24%)
ZnMc_astacin_like 59..231 CDD:239807 41/192 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.