DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-20

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_505906.2 Gene:nas-20 / 188420 WormBaseID:WBGene00003539 Length:379 Species:Caenorhabditis elegans


Alignment Length:229 Identity:61/229 - (26%)
Similarity:97/229 - (42%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGN---VVVYRISDDFDTAHKKAIQTGIDTLE 97
            |..|..:|.::::.:...|            :|..|   :..|.:..:.....:.|    |:.||
 Worm    18 VLSDRHITRDKRQAMRDYA------------KWENNKMSLFFYNLPLEMQAMFRDA----INYLE 66

  Fly    98 LHTCLRFREATDEDKAYLTVTAKSG-GCYTAVG-YQGAPQEMNLEIYPLGEGCFRPGTILHEFMH 160
            .||||:|..   .:.|...|..:.| |||:..| :.|..|::.|:.     .|...||.:||.||
 Worm    67 NHTCLKFEY---NENAETAVRIRKGNGCYSLYGMHAGEVQDLTLDY-----NCASFGTAVHEIMH 123

  Fly   161 ALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE 225
            |||..|.|:.|.|||::.|...|...|.|          .|:..|.:||.|.:.|.....|    
 Worm   124 ALGIAHGQARSDRDDYLIVDSTNSNDGIE----------NTENLVPFDYGSVMLYARDPHS---- 174

  Fly   226 DTIVPLDS--SAVIGQRVGLSSKDIDKINIMYKC 257
            |..:|:|.  :..:|. :.::..|:..:|..|.|
 Worm   175 DKRIPIDPEYNFTMGS-LRVAFYDMVLLNKFYGC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 57/199 (29%)
ZnMc_astacin_like 70..255 CDD:239807 54/191 (28%)
nas-20NP_505906.2 Astacin 36..209 CDD:279708 58/211 (27%)
ZnMc 49..205 CDD:294052 52/182 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.