DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-31

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:249 Identity:72/249 - (28%)
Similarity:109/249 - (43%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRNLEQG--------APKARNGLINTEKRWP----GNVVVYRISDDFDTAHKKAI 89
            :|||:||::|...:.:.        |.:||..... ::.:|    |:.|.|...........||.
 Worm   128 QGDMVLTDDQIATILEARDETTVSTASRARRQAYR-DRYYPSTTWGSSVYYYYDRTATPKIVKAF 191

  Fly    90 QTGIDTLELHTCLRFREATDEDKAYLTVTA-------KSGGCYTAVGYQGAPQEMNLEIYPLGEG 147
            :..:...:..||:...:::         ||       |..|||:.||.....|:::     ||.|
 Worm   192 EQAVAFWQNVTCINIMQSS---------TAINRIRVFKGQGCYSYVGRISGVQDLS-----LGTG 242

  Fly   148 CFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVG--YDYD 210
            |...||..||..|||||:|.||...||::|::.|.||.|.....|.|  :|..|:|..|  |||.
 Worm   243 CEEFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPSYVEQFDK--ETSNTNFNYGMPYDYG 305

  Fly   211 SCLHYRPGAFSINGEDTIVPLDS-------SAVIGQRVGLSSKDIDKINIMYKC 257
            |.:.|...:.|.|.:.|::..|:       |..:|      ..||..:|..|||
 Worm   306 SIMQYGATSASSNDKATMIARDTEYQDTMGSDFVG------FYDISMMNEHYKC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 63/212 (30%)
ZnMc_astacin_like 70..255 CDD:239807 59/200 (30%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 62/207 (30%)
ZnMc_astacin_like 175..351 CDD:239807 58/197 (29%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.