DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-29

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:270 Identity:73/270 - (27%)
Similarity:116/270 - (42%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SGKPLPAGVYDPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGL--------INTE-----KR-- 67
            |.||:..|..:.:......||||.::.:|...:..|:.:.|..:        ||.|     ||  
 Worm    72 SEKPISIGKLNKKYRDILFEGDMAISYKQLSMIVNGSTEYRKAIKSRRRGNKINGESTDRTKRQA 136

  Fly    68 ----------WPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSG 122
                      |. |.|.:...:......|.||...:......||:.|...|.: |.||.......
 Worm   137 YLDNNYPATIWK-NGVAFMFHESLTPIAKTAILKAVHFWYRETCIEFHPRTFQ-KEYLLFIGNDD 199

  Fly   123 GCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPG 187
            ||::.||...:   ...::..:|.||...|...||..||||.:|:||...||:  :|::...|..
 Worm   200 GCWSTVGRDAS---QGKQVVSIGNGCEHFGVTSHELAHALGIFHEQSRFDRDE--SVVFNPRVVE 259

  Fly   188 KE--FNFQKYADTVVTDFEVGYDYDSCLHYRPGAFS-INGEDTIVPLDSS--AVIGQRVGLSSKD 247
            ::  |||.|.:...::.:.:.||..|.:||.|..|| |....|:..:|::  ..:||..|.|..|
 Worm   260 RDLLFNFAKISPRQMSTYGLPYDIGSVMHYTPTEFSNIPSIPTLAAIDTNLQQTMGQLEGPSFVD 324

  Fly   248 IDKINIMYKC 257
            :..:|..|:|
 Worm   325 VHIMNQHYQC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 59/209 (28%)
ZnMc_astacin_like 70..255 CDD:239807 54/189 (29%)
nas-29NP_494953.3 Astacin 145..336 CDD:279708 57/197 (29%)
ZnMc_astacin_like 148..332 CDD:239807 54/190 (28%)
CUB 404..491 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.