DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-2

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_503678.3 Gene:nas-2 / 186345 WormBaseID:WBGene00003521 Length:272 Species:Caenorhabditis elegans


Alignment Length:208 Identity:65/208 - (31%)
Similarity:93/208 - (44%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 WPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTA--KSGGCYTAVGY 130
            ||...|.|.|:..:.:..|..|.:.::..:..||:|||.....||.||.:..  ....|::.:|.
 Worm    60 WPNAEVPYDIATHYTSTEKSIILSAMEAFKNVTCVRFRPRAATDKHYLQINKYFNVERCFSYIGR 124

  Fly   131 Q------GAPQEMNLEI-YPLGEGCFR---PGTILHEFMHALGFYHQQSSSIRDDFINVIYENIV 185
            |      |.| |.|:|. ..|...|.|   .|.::||.||.|||||:..   |||....|..:.|
 Worm   125 QSSRTLFGTP-EGNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQ---RDDRDRRIVGSAV 185

  Fly   186 PGKEFNFQKY--ADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSAVIGQRVGLSSKDI 248
               .:||:.|  |.|:   :...||.:|.:||       |.::  :|..      :|...|:.||
 Worm   186 ---HYNFKIYRRAKTL---YMGAYDANSIMHY-------NFQN--LPWQ------RRDHFSTSDI 229

  Fly   249 DKINIMYKCPILL 261
            ..||..|||..||
 Worm   230 ININTFYKCKNLL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 62/203 (31%)
ZnMc_astacin_like 70..255 CDD:239807 58/198 (29%)
nas-2NP_503678.3 Astacin 58..240 CDD:279708 63/204 (31%)
ZnMc 62..236 CDD:294052 58/198 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.