DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-28

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_498342.3 Gene:nas-28 / 185658 WormBaseID:WBGene00003546 Length:497 Species:Caenorhabditis elegans


Alignment Length:238 Identity:76/238 - (31%)
Similarity:128/238 - (53%) Gaps:30/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRN----LEQGAPKA-RNGLINTEKRWPGNVVVYRISDDFDTA--------HKKA 88
            |.|:||.|:|.::    :|.|..:: |..:::|...|..:|.::.   .|||.        .:||
 Worm    94 ESDIMLNEKQAKHIATAIENGNYRSKRQAIVDTTNFWSVSVPIFY---QFDTKLSATNIANVRKA 155

  Fly    89 IQTGIDTLELHTCLRFREATD-EDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPG 152
            ||...|    ::||.|:|..: :::.:|   :.:|||::.||.|   .:|..::..:|..|...|
 Worm   156 IQFWND----NSCLSFKEDNNAKNRLFL---SSAGGCWSYVGKQ---VDMPYQMVSVGPNCDTFG 210

  Fly   153 TILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRP 217
            |..||.|||:||:||||.:.||:::.|.:.||:|.:.:||||.|........:.|||.|.:.|.|
 Worm   211 TATHELMHAIGFWHQQSRADRDNYVYVDFSNIIPSQAYNFQKMAVDQAQLLNLPYDYGSVMQYYP 275

  Fly   218 GAFSINGED-TIVPLDS--SAVIGQRVGLSSKDIDKINIMYKC 257
            .||:::... ||:..::  ...:|||...:..||..:|.:|.|
 Worm   276 YAFAVDSSKYTILAKENGFQNSMGQREAPAFSDIIGVNKLYNC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 66/204 (32%)
ZnMc_astacin_like 70..255 CDD:239807 63/196 (32%)
nas-28NP_498342.3 Astacin 135..320 CDD:279708 64/197 (32%)
ZnMc_astacin_like 135..316 CDD:239807 62/193 (32%)
CUB 393..480 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.