DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-13

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_510549.3 Gene:nas-13 / 185492 WormBaseID:WBGene00003532 Length:450 Species:Caenorhabditis elegans


Alignment Length:201 Identity:73/201 - (36%)
Similarity:111/201 - (55%) Gaps:6/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSG 122
            ||.:..|..:|....:.|.||..:.:..:..|...|:.....||:.|...:..|..|:.: ....
 Worm   109 RNAVRQTYLKWEQARIPYTISSQYSSYSRSKIAEAIEEYRKKTCIDFSPKSAGDLDYIHI-VPDD 172

  Fly   123 GCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPG 187
            |||:.||..|..|.::     ||:||.:.|.|:||.|||:||:|:||.:.||:::.:.:.|:..|
 Worm   173 GCYSLVGRIGGKQPVS-----LGDGCIQKGIIIHELMHAVGFFHEQSRADRDEYVKINWSNVEAG 232

  Fly   188 KEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSAVIGQRVGLSSKDIDKIN 252
            .:..|.||:..::......|||.|.:||.|.|||.||:.||.|::.:..||||.|.|..||.|||
 Worm   233 LQDQFDKYSLNMIDHLGTKYDYGSVMHYAPTAFSKNGKPTIEPIEKNVEIGQRAGFSENDIYKIN 297

  Fly   253 IMYKCP 258
            ::|.||
 Worm   298 MLYNCP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 68/191 (36%)
ZnMc_astacin_like 70..255 CDD:239807 66/184 (36%)
nas-13NP_510549.3 Astacin 118..304 CDD:279708 70/192 (36%)
ZnMc_astacin_like 122..300 CDD:239807 66/183 (36%)
ShK 367..404 CDD:279838
ShK 414..450 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.