DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-12

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_501871.2 Gene:nas-12 / 182848 WormBaseID:WBGene00003531 Length:384 Species:Caenorhabditis elegans


Alignment Length:236 Identity:73/236 - (30%)
Similarity:110/236 - (46%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VEGDMMLTEEQ---QRNLEQGAPKARNGLI--NTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDT 95
            |.|||:||..|   ..|.:......|...|  ::..||..|:|.|.||..:..|.|:.:.:.:..
 Worm    46 VFGDMLLTPAQLIRYENSKDSDLSIRGVSIKGSSMNRWSNNIVPYVISPQYSPAQKQILVSSLRY 110

  Fly    96 LELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMH 160
            .|..:|.:|.|.|.::. ||.:.... |||:.||..|..|.::     |...|.....|.||.||
 Worm   111 FERVSCFKFVERTTQND-YLFIVPLD-GCYSYVGKIGGRQTLS-----LAADCIADYIIWHEMMH 168

  Fly   161 ALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE 225
            |:||.|:.....||.||.|.|.|::||:..||.|...:.| ::...||:.|.:||...||   |.
 Worm   169 AIGFEHEHQRPDRDSFIRVDYANVIPGQMINFDKLKTSHV-EYPDIYDFKSIMHYDGYAF---GR 229

  Fly   226 ---------DTIVPLDSSAVIGQRVGLSSKDIDKINIMYKC 257
                     .|:.||.....:...:..::.||:|:|.:.:|
 Worm   230 VDTARRVRLATMTPLKPGVTLEDNMKFTATDIEKLNRLGQC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 63/201 (31%)
ZnMc_astacin_like 70..255 CDD:239807 60/193 (31%)
nas-12NP_501871.2 Astacin 81..272 CDD:279708 63/201 (31%)
ZnMc_astacin_like 85..267 CDD:239807 60/192 (31%)
ShK 286..325 CDD:279838
ShK 347..384 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.