DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-7

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:237 Identity:79/237 - (33%)
Similarity:112/237 - (47%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVYDPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAI 89
            |.:.|.|.....:.|:.|....:          |||:....|.||...:.|.||..:....:..:
 Worm    56 GKHIPVEVVNDFKSDIRLPRRHK----------RNGVSRAAKLWPNARIPYAISPHYSPHERALL 110

  Fly    90 QTGIDTLELHTCLRF--REATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPG 152
            ...:......||:||  |:..:.|  ||.: .|..||::.||.....|.::|:     .||....
 Worm   111 AKAVKQYHEKTCIRFVPRQTGEPD--YLFI-GKVDGCFSEVGRTSGVQVLSLD-----NGCMEYA 167

  Fly   153 TILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRP 217
            ||:||.||.:||||:.....||:||::|::||..|....|.|...:..:.:...|||.|.|||..
 Worm   168 TIIHEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDS 232

  Fly   218 GAFSINGEDTIVPLDSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            .|||.||..|::|...||.||.....|..||.|||.||.||:
 Worm   233 LAFSKNGFPTMLPKVKSATIGNARDFSDVDISKINRMYNCPV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 69/193 (36%)
ZnMc_astacin_like 70..255 CDD:239807 64/186 (34%)
nas-7NP_495552.2 Astacin 87..274 CDD:279708 70/194 (36%)
ZnMc_astacin_like 91..270 CDD:239807 64/186 (34%)
ShK 347..382 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.