DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-6

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:273 Identity:96/273 - (35%)
Similarity:138/273 - (50%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YVLLLQVVLNS----GKPLP------AGVYDPEE----------AGGFVEGDMMLTEEQQRNLEQ 52
            :||||...|.|    .:|..      || |.||:          :|.| :||:...:.....|.:
 Worm     4 HVLLLTYCLVSTVVRSQPSADVFRSFAG-YIPEDHRVTHHEWQNSGKF-QGDIDGVDPNLLKLPE 66

  Fly    53 GAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTV 117
            | |...|.|.|.:..|.|.|:.|.:...|.....|.::...|:....||:|| |..:....||.:
 Worm    67 G-PVLFNALKNKQLTWEGGVIPYEMDTAFSPNEIKILEKAFDSYRRTTCIRF-EKREGQTDYLNI 129

  Fly   118 TAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYE 182
             .|..|||:.||..|..||::     ||.|||....|:||.||::||:|:.|.:.|||.|.:.::
 Worm   130 -VKGYGCYSQVGRTGGKQEIS-----LGRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKINWD 188

  Fly   183 NIVPGKEFNFQKYADTVVTDFE-VGYDYDSCLHYRPGAFSINGEDTIVPLDS--SAVIGQRVGLS 244
            ||:||.:..|.|.: .|:.|.: ..|||.|.:||...|||.||.:||..:::  :.|||..:.||
 Worm   189 NILPGMKSQFDKIS-AVLQDLQGENYDYKSIMHYDSTAFSRNGRNTIETVENGFTQVIGTAMDLS 252

  Fly   245 SKDIDKINIMYKC 257
            ..||.|||.:|.|
 Worm   253 PLDIVKINKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 74/195 (38%)
ZnMc_astacin_like 70..255 CDD:239807 71/187 (38%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 73/192 (38%)
ZnMc_astacin_like 83..263 CDD:239807 71/187 (38%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.