DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and hch-1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_510440.1 Gene:hch-1 / 181564 WormBaseID:WBGene00001828 Length:605 Species:Caenorhabditis elegans


Alignment Length:256 Identity:81/256 - (31%)
Similarity:123/256 - (48%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PEEAGGFVEGDMMLTEEQQ----RNLEQG-------------APKARNGLIN-TEKRWPGNVVVY 75
            |:|.....||||:||:||.    :|:...             |.:.:..:.: ..:||...|..|
 Worm    77 PDEIPYLFEGDMVLTDEQMDLIIKNVRDQYWARKSSTNEFLYAIRGKRSMTSFLSERWSFPVPYY 141

  Fly    76 RISDDFDTA---HKKAIQTGIDTLELHTCLRFR-----EATDEDKAYLTVTAKSGGCYTAVG-YQ 131
                 .||:   :..|:..|:...|..||.||.     .::....|...::  ..|||:.:| ..
 Worm   142 -----IDTSSGVNTNAVLAGVAKWEQETCARFTRLNSYSSSSRQNALRFIS--GNGCYSNIGKVS 199

  Fly   132 GAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYA 196
            ..||:::     :|.||...||:.||..|||||||:|:...|||:::::.:||.......|.|.:
 Worm   200 RFPQDVS-----IGWGCTSLGTVCHEIGHALGFYHEQARYDRDDYVSILTQNIQDMYLSQFTKQS 259

  Fly   197 DTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSS--AVIGQRVGLSSKDIDKINIMY 255
            .:.:.|:.|||||.|.:||...|||..|.:||...|.:  |.|||||..|..|:.:||..|
 Worm   260 ASSMVDYGVGYDYGSVMHYDQAAFSSTGGNTIATRDPNFQATIGQRVAPSFADVKRINFAY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 69/201 (34%)
ZnMc_astacin_like 70..255 CDD:239807 66/195 (34%)
hch-1NP_510440.1 Astacin 132..323 CDD:279708 69/201 (34%)
ZnMc_astacin_like 135..320 CDD:239807 66/196 (34%)
CUB 386..466 CDD:214483
TSP1 533..565 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.