DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-10

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001257126.1 Gene:nas-10 / 181287 WormBaseID:WBGene00003529 Length:540 Species:Caenorhabditis elegans


Alignment Length:267 Identity:77/267 - (28%)
Similarity:117/267 - (43%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVYDPEEAGGFVEGDMMLTEEQQRNL-------------EQGAPKARNGLI----NTEKRWPG-N 71
            ||..||:.|.| :.|::|||.|...:             ..|:.||:...|    |..::||. :
 Worm   246 GVVAPEDNGVF-DKDLLLTETQANFMLNELGKGGEGAIPMPGSAKAKRASIFFEQNLIQKWPSTS 309

  Fly    72 VVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKA----YLTVTAKSGGCYTAVGYQG 132
            .:.|......|...:..::..|..:|..||:||:......|.    |..|.:.|   :..:.|.|
 Worm   310 PIPYTFDSSLDNLDQNDVRGAISEIEQKTCIRFKYFASPPKGNHINYQKVNSPS---FCGLSYIG 371

  Fly   133 APQEMNLEIY---PLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQK 194
            ..:..| .:|   ..|.|   .|..:||.|||||..||.....||..|.|.:.||.|      |:
 Worm   372 RVEPAN-PVYLSFQCGNG---RGIAVHETMHALGVNHQHLRMDRDKHIKVDWSNINP------QQ 426

  Fly   195 YADTVVTD------FEVGYDYDSCLHYRPGAFSIN-GEDTIVPLDSS----AVIGQRVGLSSKDI 248
            |...||.|      :.|.|.|||.:||.....::| .:.|::||.:.    .::|||..:|:.|:
 Worm   427 YDAFVVADSKLYTTYGVKYAYDSIMHYNAYTGAVNIAKPTMIPLVNQQANIGLLGQRAKMSNADV 491

  Fly   249 DKINIMY 255
            :.:|.||
 Worm   492 EILNKMY 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 61/209 (29%)
ZnMc_astacin_like 70..255 CDD:239807 57/203 (28%)
nas-10NP_001257126.1 Astacin 303..501 CDD:396122 61/209 (29%)
ShK 503..540 CDD:396228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.