DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-37

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001024413.1 Gene:nas-37 / 181208 WormBaseID:WBGene00003553 Length:765 Species:Caenorhabditis elegans


Alignment Length:231 Identity:76/231 - (32%)
Similarity:114/231 - (49%) Gaps:26/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRNL--EQGAPKARNGLINTEKR--WPGNVVVYRISDDFDTAHKKAIQTGIDTLE 97
            |.|::||..|..:|  |..:|::|. ..:.:.|  ||...:.|......:| .::.|::.|..:|
 Worm    90 ENDIILTLPQAESLLSESNSPRSRR-QAHPDPRNFWPNLTISYEFYGGEET-WRQLIRSAIRHVE 152

  Fly    98 LHTCLRFRE-ATDED--KAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFM 159
            .:.|.:|:| ..|.|  :.|     :..||::.||..|..|     :..:|.||...|.:.||.:
 Worm   153 QNVCFKFKENGGDRDGLRYY-----RGNGCWSNVGRVGGRQ-----LVSIGYGCDSLGIVSHETL 207

  Fly   160 HALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVG--YDYDSCLHYRPGAFSI 222
            ||||.:|:||...||:||:::.:.|..|.|.||.|  .|......:|  ||..|.:||...:|:.
 Worm   208 HALGLWHEQSRDDRDNFISIVADKITRGTEGNFAK--RTAANSDNLGQPYDLGSVMHYGAKSFAY 270

  Fly   223 N-GEDTIVPLD--SSAVIGQRVGLSSKDIDKINIMY 255
            : ..|||...|  ....||||.|||.||...||..|
 Worm   271 DWSSDTIKTRDWRYQNTIGQRDGLSFKDAKMINTRY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 67/200 (34%)
ZnMc_astacin_like 70..255 CDD:239807 63/192 (33%)
nas-37NP_001024413.1 Astacin 122..309 CDD:279708 66/198 (33%)
ZnMc_astacin_like 126..306 CDD:239807 63/192 (33%)
CUB 370..455 CDD:214483
TSP1 579..626 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.