DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-15

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_508154.2 Gene:nas-15 / 180426 WormBaseID:WBGene00003534 Length:571 Species:Caenorhabditis elegans


Alignment Length:241 Identity:82/241 - (34%)
Similarity:124/241 - (51%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VYDPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNG-----LINTEKRWPGNVVVYRISDDFDTAH 85
            :|..:...|.:..|.:.....:.....|:.|:.:|     :.|..:.||...:.|.||..:.:..
 Worm    76 MYSKDRFEGDIANDNLNASTAELFANGGSGKSEDGKWYNAIKNRLQLWPEGRIPYTISSQYSSYS 140

  Fly    86 KKAIQTGIDTLELHTCLRF--REATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGC 148
            :..|...:.....|||:|:  :||.|.:..::   ....|||:.||..|..|.::     ||.||
 Worm   141 RSLIAASMQEYASHTCIRWVPKEAADVNYVHI---YPDRGCYSMVGKMGGKQSLS-----LGSGC 197

  Fly   149 FRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCL 213
            .:.|.||||.|||:||:|:||.:.|||.|.:::.||..|.:..|:||....:.....||||.|.:
 Worm   198 IQKGIILHELMHAVGFFHEQSRTDRDDHITIMWNNIQAGMQGQFEKYGHGTIQSLGTGYDYGSIM 262

  Fly   214 HYRPGAFSINGEDTIVPLDSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            ||...|||.||:.|::|..:.|.||||.|.|..|..|||.:|.||:
 Worm   263 HYGTKAFSRNGQPTMIPKKNGATIGQRNGFSKVDKFKINTLYGCPV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 73/193 (38%)
ZnMc_astacin_like 70..255 CDD:239807 70/186 (38%)
nas-15NP_508154.2 Astacin 121..308 CDD:279708 74/194 (38%)
ZnMc_astacin_like 126..304 CDD:239807 70/185 (38%)
ShKT 354..388 CDD:214586
ShK 436..471 CDD:279838
Gag_MA <472..531 CDD:279482
ShK 535..571 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.