Sequence 1: | NP_001285958.1 | Gene: | CG15255 / 34913 | FlyBaseID: | FBgn0028950 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497769.3 | Gene: | toh-1 / 175491 | WormBaseID: | WBGene00006591 | Length: | 414 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 59/203 - (29%) |
---|---|---|---|
Similarity: | 91/203 - (44%) | Gaps: | 21/203 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 WPGNVVVYRI-SDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTA-VGY 130
Fly 131 QGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNF--- 192
Fly 193 ----QKYADTVVTDFEVGYDYDSCLHYRPGAFSINGED-TIVPLDSSAV--IGQRVGLSSKDIDK 250
Fly 251 INIMYKCP 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15255 | NP_001285958.1 | Astacin | 66..258 | CDD:279708 | 57/201 (28%) |
ZnMc_astacin_like | 70..255 | CDD:239807 | 55/196 (28%) | ||
toh-1 | NP_497769.3 | Astacin | 71..265 | CDD:279708 | 59/203 (29%) |
ZnMc_astacin_like | 73..262 | CDD:239807 | 55/196 (28%) | ||
CUB | 320..410 | CDD:214483 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |