DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and toh-1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:203 Identity:59/203 - (29%)
Similarity:91/203 - (44%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 WPGNVVVYRI-SDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTA-VGY 130
            |....:.::| ..|::  .:..|:.||...|..|||||:|......|...|..|...|:|. :|.
 Worm    71 WNSYEIPFQIWGGDYN--FQSLIRRGIRMWEDSTCLRFKENQQSRDAIRYVLEKGDSCFTEYIGR 133

  Fly   131 QGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNF--- 192
            .|..|::     .:|..|.....:.||..|||||:|......||..|::.::|::.....:|   
 Worm   134 NGGHQDI-----IIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWKNVMEEATASFMPF 193

  Fly   193 ----QKYADTVVTDFEVGYDYDSCLHYRPGAFSINGED-TIVPLDSSAV--IGQRVGLSSKDIDK 250
                |.:....|:...|.|||.|.:||...|.::...| ||||.:...|  :|.. .::..|...
 Worm   194 RSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELKYVTTMGTE-KMAFLDAKV 257

  Fly   251 INIMYKCP 258
            ||.:| ||
 Worm   258 INDIY-CP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 57/201 (28%)
ZnMc_astacin_like 70..255 CDD:239807 55/196 (28%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 59/203 (29%)
ZnMc_astacin_like 73..262 CDD:239807 55/196 (28%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.