DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Mep1a

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:220 Identity:75/220 - (34%)
Similarity:119/220 - (54%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NLEQG---APKARNGLINTEKRW--PGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREAT 108
            ||.||   .|:.||.:.:...||  |   :.|.::|:.:...|.||....:...|.:|:.|:...
Mouse    65 NLFQGDILLPRTRNAMRDPSSRWKLP---IPYILADNLELNAKGAILHAFEMFRLKSCVDFKPYE 126

  Fly   109 DEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIR 173
            .| .:|: :..|..||::.:|.|...|.::     :||||....||.||.:|||||:|:||.:.|
Mouse   127 GE-SSYI-IFQKLSGCWSMIGDQQVGQNIS-----IGEGCDFKATIEHEILHALGFFHEQSRTDR 184

  Fly   174 DDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTI------VPLD 232
            ||::|:.::.|:...|.||..|.|..:||....|||:|.:||  |.||.|..::|      :| :
Mouse   185 DDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHY--GPFSFNKNESIPTITTKIP-E 246

  Fly   233 SSAVIGQRVGLSSKDIDKINIMYKC 257
            .:.:|||....|:.|:.::|.||.|
Mouse   247 FNTIIGQLPDFSAIDLIRLNRMYNC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 68/200 (34%)
ZnMc_astacin_like 70..255 CDD:239807 62/190 (33%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 74/218 (34%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44135
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.