DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and nas-36

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:230 Identity:69/230 - (30%)
Similarity:105/230 - (45%) Gaps:19/230 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRNLEQGAPK------ARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDT 95
            |||:.|:..|..::.:...|      .|:.:.:....|....:.||..:..|......|...|..
 Worm    99 EGDIFLSRRQAVDILKALSKDKTKRLRRSFVSDKTATWKTMPIKYRFHESIDFYTISQIIAAIRF 163

  Fly    96 LELHTCLRFREATDE-DKAYLTVTAKSG-GCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEF 158
            .|..||:.|...:|. |..|:...  || |||:.:|..|..|.::     :||.|.:.|.|.||.
 Worm   164 WEDSTCITFENVSDSPDGDYIEFF--SGQGCYSMIGRNGGRQGIS-----IGESCVKMGVIEHEI 221

  Fly   159 MHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSIN 223
            .||||.:|:||......::.:..:.|:|....:|.:..|.:.| ..:.||..|.:||...|||::
 Worm   222 GHALGLWHEQSRPDALGYVTIERDFILPSYISDFLQRDDEIDT-LGIPYDLGSVMHYGSTAFSVD 285

  Fly   224 GED-TIVPLDS--SAVIGQRVGLSSKDIDKINIMY 255
            .:. |:|..||  ...||||..||..|:..||..|
 Worm   286 QKSKTVVTRDSLYQQTIGQREKLSFYDVATINTAY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 62/195 (32%)
ZnMc_astacin_like 70..255 CDD:239807 60/189 (32%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 62/195 (32%)
ZnMc_astacin_like 140..320 CDD:239807 60/187 (32%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.