DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and astl2d.2

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_031756346.1 Gene:astl2d.2 / 105947175 XenbaseID:XB-GENE-22069740 Length:517 Species:Xenopus tropicalis


Alignment Length:295 Identity:84/295 - (28%)
Similarity:141/295 - (47%) Gaps:54/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IYVLLLQVVLNSGKPLPAGVYDPEEAGG-------FVEGD----MMLTEEQQRNL---------- 50
            |.::|:..:|  |:.|.|.:.|.:.:..       |.|.|    |....|:|.:.          
 Frog     5 ICIILVSCLL--GRVLSAPLQDTDSSDNNNEQNDFFGEDDFYSLMTKANEEQNDFFGEDDFYSLM 67

  Fly    51 -----------EQG---APKARNGLINTEKRWP---GNVVV-YRISDDFDTAHKKAIQTGIDTLE 97
                       .||   ...:|:.::.|:..|.   |.|.| |.:...:.:.....|.:.::...
 Frog    68 TKANEGSRVRRVQGDIAVRVSRSTIVCTDCFWQKSNGIVYVPYTLDKQYSSDQINTITSAMEVYS 132

  Fly    98 LHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEG-CFRPGTILHEFMHA 161
            ..||::|...|||:. |:.:|: ..||::.:|.||..|.:::|     :| |...||.:||..||
 Frog   133 TLTCVQFVPYTDEED-YIAITS-GDGCWSYMGRQGGAQVVSVE-----KGYCTSEGTTMHELNHA 190

  Fly   162 LGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFS-INGE 225
            |||.|:||.|.||::::::|:.|.||...||:|..   ..:....|||.|.:||...||| ..|:
 Frog   191 LGFVHEQSRSDRDNYVDIMYQYISPGDIVNFKKME---TNNLNTTYDYHSIMHYPAWAFSNTTGQ 252

  Fly   226 DTIV-PLDSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            :||| .|:.:..:|....:::.||.|||.:|:|.:
 Frog   253 NTIVAKLNPNTPLGPGSTMTNLDITKINRLYQCDV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 66/198 (33%)
ZnMc_astacin_like 70..255 CDD:239807 64/188 (34%)
astl2d.2XP_031756346.1 ZnMc 103..285 CDD:412141 65/191 (34%)
CUB 288..399 CDD:238001 84/295 (28%)
CUB 402..513 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.