DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and astl3a.3

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_031746774.1 Gene:astl3a.3 / 100498584 XenbaseID:XB-GENE-22069675 Length:529 Species:Xenopus tropicalis


Alignment Length:305 Identity:101/305 - (33%)
Similarity:140/305 - (45%) Gaps:63/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLLLQVVLNSGKPLPAGVYDP----------------EEAGGFVEGDMMLTEEQQRNLE------ 51
            ::||..::.|....||.:..|                |..|...|.|.:.||...|.:|      
 Frog     9 IILLACIMGSAWTYPAQIIFPYQEMLEKDSLTNLDLLEALGKSAEKDALATEGTVRGMEMPVLGK 73

  Fly    52 -----------------------QG---APKARNGLINTEKRWP----GNVVV-YRISDDFDTAH 85
                                   ||   .||.|:.:..||..||    |.|:| |..|.::....
 Frog    74 KSGSVDVFTQISKVNRGIRVPTYQGDILRPKGRSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQ 138

  Fly    86 KKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFR 150
            ....::.:...|..||:||....:|.. :|::.: ..||.:.:|..|..|.:.|:.|    ||..
 Frog   139 LALFKSTMQEYESLTCVRFVPRANETD-FLSIVS-DNGCASFLGKVGGDQTVQLDSY----GCIY 197

  Fly   151 PGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHY 215
            .|.|.||..|||||||:||.|.|||::.:..|||:||.|.||.| ||:  .:..:.|||.|.:||
 Frog   198 RGIIQHELNHALGFYHEQSRSDRDDYVTIHTENIIPGYEGNFNK-ADS--NNLGLEYDYSSVMHY 259

  Fly   216 RPGAFSINGEDTIVPL-DSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            ...|||.||..||||. |.:..||||.|||..|:.|||.:|:|.:
 Frog   260 SGDAFSKNGNLTIVPKPDPTVPIGQRDGLSILDVSKINRLYQCDV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 79/197 (40%)
ZnMc_astacin_like 70..255 CDD:239807 76/186 (41%)
astl3a.3XP_031746774.1 ZnMc_hatching_enzyme 121..302 CDD:239810 77/189 (41%)
CUB 306..414 CDD:238001
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.