DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and LOC100496745

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017948777.1 Gene:LOC100496745 / 100496745 -ID:- Length:432 Species:Xenopus tropicalis


Alignment Length:232 Identity:78/232 - (33%)
Similarity:132/232 - (56%) Gaps:28/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VEGDMMLTEEQQRNLEQGA----PKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTL 96
            ::||:.:.:.:...:..|.    |::|.||:         :|.|.:|:::::..:..|:..:|.:
 Frog     2 IQGDIAVKKSRNALMCPGKSCLWPRSRKGLV---------LVPYTLSNNYNSTERDIIRAAMDEV 57

  Fly    97 ELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHA 161
            .:.||::|....:|.. ||.:.... ||::.:|..|..|:::|    :..||...|.|.||.:|:
 Frog    58 TVLTCIQFVTYNNESD-YLRIRPYD-GCWSYIGRVGGAQDVSL----MKTGCLHHGVIQHELLHS 116

  Fly   162 LGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVG--YDYDSCLHYRPGAFSIN- 223
            |||.|:|..|.||::||:.::||...||.||.|     :....:|  |||.|.:||...||:.| 
 Frog   117 LGFQHEQCRSDRDNYININWDNISHDKERNFLK-----MNTQNLGSPYDYLSVMHYGKFAFATNS 176

  Fly   224 GEDTIVPL-DSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            |:.|:.|. :.||:|||||||||.|::|||.:|:|.:
 Frog   177 GKPTLEPKGNPSAMIGQRVGLSSLDVEKINRLYQCSV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 70/195 (36%)
ZnMc_astacin_like 70..255 CDD:239807 69/188 (37%)
LOC100496745XP_017948777.1 ZnMc 30..211 CDD:412141 72/200 (36%)
CUB 232..321 CDD:238001
CUB 324..428 CDD:395345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.