DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and accs

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017948750.2 Gene:accs / 100495810 XenbaseID:XB-GENE-989873 Length:492 Species:Xenopus tropicalis


Alignment Length:266 Identity:82/266 - (30%)
Similarity:131/266 - (49%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LPAGVYDPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVV------------ 74
            ||:|.|:.|||             ...::.....|:.||.:  :|.|.|::.:            
 Frog    20 LPSGNYEDEEA-------------YHEDVFSQILKSNNGTV--KKLWQGDIAIETGRSATKCTSC 69

  Fly    75 -------------YRISDDFDTAHKKAIQTGIDTLELHTCLRFRE-ATDEDKAYLTVTAKSGGCY 125
                         ||:|.|:....|.:|:..:......||:.|.| :|:||  :|.:.:.| ||:
 Frog    70 LWPKSADGTVRVPYRLSADYSDNEKSSIRDALLEFNTLTCVHFVERSTEED--FLDIVSDS-GCW 131

  Fly   126 TAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEF 190
            :::|..|..|.::|    :..||...|.|.||..|||||||:||.|.||.:|:|:::.|......
 Frog   132 SSIGRTGGAQTLSL----MSSGCLAKGIIQHEVDHALGFYHEQSRSDRDTYIDVLWQYICESDWG 192

  Fly   191 NFQKYADTVVTDFEVGYDYDSCLHYRPGAFS-INGEDTIVPL-DSSAVIGQRVGLSSKDIDKINI 253
            :|: ..||  .:.::.|||.|.:||...||| .:|:.::.|. |.:|.||||.|||..|:.|:..
 Frog   193 SFE-MVDT--DNLDLPYDYSSVMHYGWYAFSNTSGQPSLRPKPDPTANIGQRYGLSPLDVSKVKE 254

  Fly   254 MYKCPI 259
            :|.|.:
 Frog   255 LYGCKL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 71/219 (32%)
ZnMc_astacin_like 70..255 CDD:239807 68/212 (32%)
accsXP_017948750.2 ZnMc 76..258 CDD:412141 68/191 (36%)
CUB 261..374 CDD:238001 82/266 (31%)
CUB 377..488 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.