DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and astl2d.5

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:220 Identity:73/220 - (33%)
Similarity:118/220 - (53%) Gaps:19/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QRNLEQGAPKARNGLINTEKRWP---GNVVV-YRISDDFDTAHKKAIQTGIDTLELHTCLRFREA 107
            |.::..|.  :|:.:..||..|.   |.|.| |.:.|.:..:....:.:.::.....||::|...
 Frog    60 QEDIAVGV--SRSAITYTECLWQKTNGTVYVPYTLDDKYSNSEVNTMTSAMEVYATLTCVQFVPY 122

  Fly   108 TDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEG-CFRPGTILHEFMHALGFYHQQSSS 171
            ||||. |:.:|: ..||::.:|.|...|.:::|     :| |...||.:||..|||||.|:||.|
 Frog   123 TDEDD-YVNITS-GDGCWSYMGRQRGAQVVSVE-----KGYCTSEGTTMHELNHALGFVHEQSRS 180

  Fly   172 IRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFS-INGEDTIVPL-DSS 234
            .||:::|::|:.|.||....|:|...   .:....|||.|.:||...||| ..|::|||.. :.:
 Frog   181 DRDNYVNIMYQYISPGDVAEFKKMES---NNLGTTYDYRSVMHYPAWAFSNTTGQNTIVAKPNPN 242

  Fly   235 AVIGQRVGLSSKDIDKINIMYKCPI 259
            .:||....::|.||.|||.:|:|.:
 Frog   243 IIIGAGNTMTSLDIIKINRLYECDV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 67/198 (34%)
ZnMc_astacin_like 70..255 CDD:239807 65/188 (35%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 66/191 (35%)
CUB 268..377 CDD:395345 73/220 (33%)
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.