DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and astl2a

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_002934118.2 Gene:astl2a / 100492493 XenbaseID:XB-GENE-5966804 Length:492 Species:Xenopus tropicalis


Alignment Length:207 Identity:70/207 - (33%)
Similarity:110/207 - (53%) Gaps:24/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRF--REATDEDKAYLTV 117
            ||::||.:         :|.||||.|:..:..::|...:......||:||  |.|   ::.::.:
 Frog    77 PKSQNGSV---------LVPYRISADYGVSDIESITDAMLEFSTLTCVRFVPRSA---ERDHVII 129

  Fly   118 TAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYE 182
            .::: ||:::.|..|..|.::|    |...|...|.|.||..|.||..|:.|...||::|.||..
 Frog   130 RSEN-GCFSSKGRLGGAQTVSL----LKPDCVEFGIIQHELNHVLGLAHENSRMDRDEYITVIET 189

  Fly   183 NIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFS-INGEDTIVP-LDSSAVIGQRVGLSS 245
            ||......:|:|....:|   .:.|||:|.:||..|||| ..|..|:|| .:.:|.:||..|||:
 Frog   190 NIPAEFHRDFEKPESDIV---GMEYDYNSVMHYGSGAFSNTGGMSTLVPKRNPNAQLGQLYGLSN 251

  Fly   246 KDIDKINIMYKC 257
            .|:.|||.:|:|
 Frog   252 LDVSKINRLYEC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 66/196 (34%)
ZnMc_astacin_like 70..255 CDD:239807 64/188 (34%)
astl2aXP_002934118.2 ZnMc 81..263 CDD:412141 67/201 (33%)
CUB 267..377 CDD:238001
CUB 380..491 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.