DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and astl3c

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_002937470.2 Gene:astl3c / 100491451 XenbaseID:XB-GENE-22069695 Length:533 Species:Xenopus tropicalis


Alignment Length:292 Identity:102/292 - (34%)
Similarity:137/292 - (46%) Gaps:52/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IYVLLLQVVLNSGKPLPAGVYDPEEAGGFVEGDMMLTEEQQRNLEQGAP-----------KARNG 60
            |.::||..|:.|....||.|..|..|.|......:|.|.::.......|           :|..|
 Frog     5 ISIILLTCVIESVWSFPAQVTMPALADGITASKEILEENKKSGPGNKKPESSVDVFTQIAEANKG 69

  Fly    61 ----------LIN-------TEKRWP----GNVVV-----YRISDDFDTAHKKAIQTGIDTLELH 99
                      |||       ::..||    |.|||     |..|.|..|..|.|:|. .:||   
 Frog    70 NMALTEGGDILINIGRSATSSDYLWPKSADGTVVVPYIFSYNYSADELTLFKTAMQE-FETL--- 130

  Fly   100 TCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGF 164
            ||:||...|.: :.:|.:.: :|||.:.||..|..|::.|..|    ||...|.|.||..|||||
 Frog   131 TCVRFVPKTIQ-RDFLNIVS-NGGCLSMVGRNGGGQKVELASY----GCMSRGVIQHELNHALGF 189

  Fly   165 YHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSIN-GEDTI 228
            ||:...|.|||::.:|.|||:|..|..|.|   ....:..:.|||:|.:||....|||: .:.||
 Frog   190 YHEHMRSDRDDYVTIITENIIPSYENYFSK---RKTNNMGIIYDYNSVMHYSRNTFSISPDKSTI 251

  Fly   229 VPL-DSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            ||. |.|..||||.|||..||.||..:|:|.:
 Frog   252 VPKPDPSIPIGQRDGLSILDILKIKKLYQCDV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 82/202 (41%)
ZnMc_astacin_like 70..255 CDD:239807 79/191 (41%)
astl3cXP_002937470.2 ZnMc 99..281 CDD:381785 80/194 (41%)
CUB 290..393 CDD:366096
CUB 398..508 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.