DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and LOC100488711

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_031756326.1 Gene:LOC100488711 / 100488711 -ID:- Length:497 Species:Xenopus tropicalis


Alignment Length:257 Identity:80/257 - (31%)
Similarity:130/257 - (50%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVYDPEEAGGFVEGDMM--LTEEQQRNLEQGAPK---------ARNGLINTEKRWPGN----VVV 74
            |..||     |.:||:.  :.:..|.|   |.|:         :|:.:.:||..|...    .|.
 Frog    32 GKSDP-----FGQGDVFSRILKANQGN---GVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVP 88

  Fly    75 YRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNL 139
            |.:...:..:....:.:.::.....||::|...||||. |:.:|: ..||::.:|.||..|.:::
 Frog    89 YTLDSKYSNSEVNTMTSAMEVYATLTCVQFVPYTDEDD-YVNITS-GDGCWSYMGRQGGAQVVSV 151

  Fly   140 EIYPLGEG-CFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQ----KYADTV 199
            |     :| |...||.:||..|||||.|:.|.|.||:::|::|:.|.||...||:    ...:|:
 Frog   152 E-----KGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTNNLNTI 211

  Fly   200 VTDFEVGYDYDSCLHYRPGAFS-INGEDTIV-PLDSSAVIGQRVGLSSKDIDKINIMYKCPI 259
                   |||.|.:||...||| ..|::||| .|:.:.:||....::|.||.|||.:|:|.:
 Frog   212 -------YDYRSIMHYPAWAFSNTTGKNTIVAKLNPNIIIGAGSTMTSLDIIKINRLYECDV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 66/202 (33%)
ZnMc_astacin_like 70..255 CDD:239807 64/195 (33%)
LOC100488711XP_031756326.1 ZnMc 82..264 CDD:412141 65/195 (33%)
CUB 276..373 CDD:214483
CUB 378..489 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.