DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and mep1ba

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:237 Identity:82/237 - (34%)
Similarity:125/237 - (52%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VYDPEEAGG--FVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKA 88
            :::..|..|  .||||::        :|:|  ::||.::..:.||| ..|.|.:.:..:...|..
Zfish    40 IFEINEVAGLDLVEGDIL--------IEEG--ESRNTILGEQYRWP-TTVPYFLDNSLEINAKGV 93

  Fly    89 IQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVG-YQGAPQEMNLEIYPLGEGCFRPG 152
            |....:...|.||:.|:....|.. |:.| .|..|||:.|| .|...||::     :|..|...|
Zfish    94 ILKAFEQYRLKTCIDFKPWNGESN-YIFV-FKGSGCYSKVGNRQMGKQELS-----IGSNCDSLG 151

  Fly   153 TILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRP 217
            |:.|||:||||.:|:||.|.|||::.::::.|..|||.||..|.:|..:...|.|||.|.:||..
Zfish   152 TVEHEFLHALGLWHEQSRSDRDDYVIIVWDQIQDGKEHNFNLYDETQSSSLGVPYDYSSVMHYSK 216

  Fly   218 GAFSINGEDTIVPL--DSSAVIGQRVGLSSKDIDKINIMYKC 257
            .:|:...|.|||..  :...|||||:..|..|:.|:|.:|.|
Zfish   217 TSFNKGSEPTIVTKIPEFLNVIGQRMEFSDNDLLKLNRLYNC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 72/195 (37%)
ZnMc_astacin_like 70..255 CDD:239807 67/187 (36%)
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 81/235 (34%)
Astacin 72..260 CDD:279708 72/195 (37%)
MAM 268..432 CDD:279023
MAM 268..430 CDD:99706
MATH_Meprin_Beta 430..599 CDD:239751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.