DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and LOC100003133

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_001342763.2 Gene:LOC100003133 / 100003133 -ID:- Length:276 Species:Danio rerio


Alignment Length:223 Identity:81/223 - (36%)
Similarity:125/223 - (56%) Gaps:18/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNV-VVYRISDDFDTAHKKAIQTGIDTLELHT 100
            |||:.::...|:|.     .||:.|  ..|...||| :.|.:|..:|.|..|.|:.|::.:|..|
Zfish    67 EGDIAVSGRSQKNC-----FARSCL--WTKSVDGNVYIAYSLSHAYDDADVKNIKEGMELIEQDT 124

  Fly   101 CLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFY 165
            |:||...|.: :.||.:..|: ||::.:|.:|..|.::|:    ...|...|..:||.||||||.
Zfish   125 CVRFVPRTHQ-RDYLDIQPKT-GCWSYLGARGGRQTISLQ----SPDCTGSGVTVHELMHALGFV 183

  Fly   166 HQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVP 230
            |:||.:.||.::.:::.||...:..||:|:.   ..:.:..|||.|.:|:...|||.:||.||||
Zfish   184 HEQSRADRDKYVTIMWSNIWKDRLRNFEKFK---TNNLDTPYDYSSVMHFGKYAFSEDGEPTIVP 245

  Fly   231 LDS-SAVIGQRVGLSSKDIDKINIMYKC 257
            ..: :..||||:|.|..||.|||.:|.|
Zfish   246 KRNWNVKIGQRLGPSDLDIMKINKLYSC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 73/194 (38%)
ZnMc_astacin_like 70..255 CDD:239807 70/186 (38%)
LOC100003133XP_001342763.2 ZnMc_hatching_enzyme 92..273 CDD:239810 71/189 (38%)
Astacin 97..274 CDD:279708 69/186 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.