DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and LGI1

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_005088.1 Gene:LGI1 / 9211 HGNCID:6572 Length:557 Species:Homo sapiens


Alignment Length:270 Identity:70/270 - (25%)
Similarity:103/270 - (38%) Gaps:74/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LHLLLWLLCCCSQL----GQ--LRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDL 117
            |..:.:.||..|.|    |:  .:.:|||||.|.    |::.||.||.  .||            
Human    16 LKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCT----KDNALCENAR--SIP------------ 62

  Fly   118 SGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYH 182
                 :.:|.|      :::|..|           |..|        .::|:......|||.|  
Human    63 -----RTVPPD------VISLSFV-----------RSGF--------TEISEGSFLFTPSLQL-- 95

  Fly   183 VSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSE 247
                  |..:.|....:.||||..:|.|..|.:.:..:..|:...|.||:|.:. |.|..|.|..
Human    96 ------LLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIH-LSLANNNLQT 153

  Fly   248 VRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT-----CESPPRLSGRAWD 307
            :.......|.||..::|..|::||.|.|:.|..|:...|      .|     ||.||....|..:
Human   154 LPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTN------ATVEDIYCEGPPEYKKRKIN 212

  Fly   308 KLDVDDFACV 317
            .|...||.|:
Human   213 SLSSKDFDCI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 33/156 (21%)
leucine-rich repeat 112..137 CDD:275380 2/24 (8%)
LRR_8 137..196 CDD:290566 11/58 (19%)
leucine-rich repeat 138..161 CDD:275380 4/22 (18%)
leucine-rich repeat 162..185 CDD:275380 5/22 (23%)
LRR_8 184..245 CDD:290566 17/60 (28%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..234 CDD:275380 6/23 (26%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 17/53 (32%)
IG_like 328..428 CDD:214653
Ig 335..425 CDD:143165
LGI1NP_005088.1 leucine-rich repeat 71..92 CDD:275378 5/39 (13%)
LRR_8 91..151 CDD:404697 21/68 (31%)
LRR 1 92..113 9/28 (32%)
leucine-rich repeat 93..116 CDD:275378 8/30 (27%)
LRR 2 116..137 4/20 (20%)
leucine-rich repeat 117..140 CDD:275378 6/22 (27%)
LRR 3 140..161 5/21 (24%)
leucine-rich repeat 141..164 CDD:275378 5/23 (22%)
PCC 146..>221 CDD:188093 24/80 (30%)
leucine-rich repeat 165..177 CDD:275378 3/11 (27%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 225..267
EPTP 225..264 CDD:397689
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 271..313
EPTP 272..310 CDD:397689
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 317..364
EPTP 317..361 CDD:397689
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 366..415
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 419..462
EPTP 420..459 CDD:397689
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 464..506
EPTP 464..502 CDD:397689
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 510..552
EPTP 510..549 CDD:397689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.