Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335529.1 | Gene: | lrrc38b / 799882 | ZFINID: | ZDB-GENE-141216-65 | Length: | 291 | Species: | Danio rerio |
Alignment Length: | 254 | Identity: | 78/254 - (30%) |
---|---|---|---|
Similarity: | 107/254 - (42%) | Gaps: | 41/254 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 CPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYL 143
Fly 144 ARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVP 208
Fly 209 QLVKLEL-SDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCS 272
Fly 273 CSLRPLRAWMLQQN---IPSGIP-PTCESPPRLSGR--AWDKLDVDDF-ACVPQIVATD 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 47/157 (30%) |
leucine-rich repeat | 112..137 | CDD:275380 | 7/24 (29%) | ||
LRR_8 | 137..196 | CDD:290566 | 15/58 (26%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 184..245 | CDD:290566 | 23/61 (38%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 10/24 (42%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 8/22 (36%) | ||
LRRCT | 267..316 | CDD:214507 | 18/55 (33%) | ||
IG_like | 328..428 | CDD:214653 | |||
Ig | 335..425 | CDD:143165 | |||
lrrc38b | XP_021335529.1 | LRRNT | 26..56 | CDD:214470 | 10/32 (31%) |
leucine-rich repeat | 36..58 | CDD:275380 | 5/21 (24%) | ||
PLN00113 | <43..>185 | CDD:331614 | 50/168 (30%) | ||
leucine-rich repeat | 59..79 | CDD:275380 | 7/45 (16%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 102..163 | CDD:316378 | 23/61 (38%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 128..152 | CDD:275380 | 10/24 (42%) | ||
leucine-rich repeat | 153..176 | CDD:275380 | 8/22 (36%) | ||
TPKR_C2 | 185..235 | CDD:326558 | 17/52 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |