DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lrrc24

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_031759297.1 Gene:lrrc24 / 779773 XenbaseID:XB-GENE-923418 Length:569 Species:Xenopus tropicalis


Alignment Length:421 Identity:114/421 - (27%)
Similarity:169/421 - (40%) Gaps:66/421 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYL 143
            |||.|.|.    ..:|.|.:..|..:|..:...||.:.|..|.|..|  .....:.|..||.:||
 Frog    55 CPAECRCY----SMTVECGSKELRSVPSSIHPSTQTVFLQDNAISQI--QQLDLSPLSGLQYLYL 113

  Fly   144 ARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVP 208
            ....:..:|..||:...:|:||.|:.|.:..|.|.....:..||.|.|:||.|.|:....|..:.
 Frog   114 QNNSISALEPGAFKSQQHLLELALNGNRIHLINSSIFKGLEHLRVLYLAGNQITRLLAYTFSDLQ 178

  Fly   209 QLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSC 273
            :|.:|.|.:..:..:..:||:|| |||..|.|..|.:..:....:..|.||..|.|..|.|.|.|
 Frog   179 RLQELHLQENSIETLQDQAFSGL-SSLALLDLSKNNMRTISRSALRPLISLQVLRLTENPWRCDC 242

  Fly   274 SLRPLRAWMLQ--QNIPSGIPP--TCESPPRLSGRAWDKLDVDDFACVPQIVAT---DTTAHGVE 331
            :|..||||:..  |.:.|.:..  .|..||||..::...:..:...|:|.:|..   :.||.  .
 Frog   243 ALHWLRAWIKDEGQRLLSSLDKKIICSEPPRLLHQSLVDISGNSLVCIPPMVLVEPMEVTAR--L 305

  Fly   332 GRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPR-TAAATQGRKTYV--------V 387
            |..:.:||...|.|||.|.|    |.:::...|       .|: ...:|..||..:        .
 Frog   306 GEELRVSCRATGYPQPLVTW----RKVSHARTG-------PPKINVKSTSSRKFELSERSVGEQF 359

  Fly   388 NMLRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAV---------------SRRP----- 432
            :....:..|.:....|..||.|.|.|.|..|..:....|||               |:.|     
 Frog   360 DAATGSGMLFLNNISMSHAGKYECVASNPGGTAKVLFHLAVNLSNQQSRTYTSADISQEPLYDLE 424

  Fly   433 ----------PEAPWGVRIILLGAVAALLLV 453
                      .:....:.|.||...|.||:|
 Frog   425 SMEFNALSMATQTAIAIGISLLALTAMLLIV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 48/156 (31%)
leucine-rich repeat 112..137 CDD:275380 7/24 (29%)
LRR_8 137..196 CDD:290566 20/58 (34%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
LRR_8 184..245 CDD:290566 22/60 (37%)
leucine-rich repeat 186..209 CDD:275380 9/22 (41%)
leucine-rich repeat 210..234 CDD:275380 7/23 (30%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 16/52 (31%)
IG_like 328..428 CDD:214653 25/108 (23%)
Ig 335..425 CDD:143165 23/98 (23%)
lrrc24XP_031759297.1 LRRNT 54..85 CDD:214470 9/33 (27%)
leucine-rich repeat 65..83 CDD:275380 4/17 (24%)
leucine-rich repeat 84..107 CDD:275380 7/24 (29%)
PPP1R42 87..>236 CDD:411060 46/151 (30%)
LRR_8 106..166 CDD:404697 20/59 (34%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..203 CDD:275380 7/23 (30%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
LRRCT 236..289 CDD:214507 16/52 (31%)
Ig_3 291..387 CDD:404760 26/108 (24%)
Ig strand A 291..295 CDD:409353 1/3 (33%)
Ig strand A' 300..304 CDD:409353 1/3 (33%)
Ig strand B 307..316 CDD:409353 2/8 (25%)
Ig strand C 322..328 CDD:409353 3/9 (33%)
Ig strand C' 345..348 CDD:409353 1/2 (50%)
Ig strand D 356..359 CDD:409353 0/2 (0%)
Ig strand E 366..372 CDD:409353 1/5 (20%)
Ig strand F 379..387 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14083
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.