DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lgi4

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001039090.1 Gene:lgi4 / 733906 XenbaseID:XB-GENE-1013883 Length:578 Species:Xenopus tropicalis


Alignment Length:277 Identity:67/277 - (24%)
Similarity:97/277 - (35%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PQRRLHPPLRPRLPLHLHLLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQP 107
            |||.:...:|..:...|.|.|..||........|..||..|.|.    .::|||  ...|:||..
 Frog    16 PQRTMELVIRLSIGTILFLSLLPLCQAKLARPPRWRCPLGCNCT----IDNVLC--DGTTYIPST 74

  Fly   108 LDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLL 172
            .......:.:......:||..||..:  ::||.:....|....|...||:.|.||..|.:..|  
 Frog    75 FSTDIVSVSIMRCRFPVIPPGSFTPS--MSLQILLFTSCSFDAIADDAFQGLRNLEYLFIENN-- 135

  Fly   173 SAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEW 237
                                                          |:..|:..||.||. .|..
 Frog   136 ----------------------------------------------RIKSISRNAFRGLH-LLVH 153

  Fly   238 LKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWM--LQQNIPSGIPPTCESPPR 300
            |.|..|.|..:..|...||.::..::|..|..:|.|.::.|..|.  :.:||....|..||.|.:
 Frog   154 LSLANNHLEFLPRGLFLSLPAVKHIDLQGNPLHCGCPIKWLMQWTRGVGKNISLRPPLPCEEPAK 218

  Fly   301 LSGRAWDKLDVDDFACV 317
            ..|::...|...||.||
 Frog   219 HRGKSLADLTDKDFNCV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 30/156 (19%)
leucine-rich repeat 112..137 CDD:275380 4/24 (17%)
LRR_8 137..196 CDD:290566 11/58 (19%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 3/22 (14%)
LRR_8 184..245 CDD:290566 10/60 (17%)
leucine-rich repeat 186..209 CDD:275380 0/22 (0%)
leucine-rich repeat 210..234 CDD:275380 6/23 (26%)
leucine-rich repeat 235..258 CDD:275380 8/22 (36%)
LRRCT 267..316 CDD:214507 15/50 (30%)
IG_like 328..428 CDD:214653
Ig 335..425 CDD:143165
lgi4NP_001039090.1 LRR_8 102..161 CDD:290566 21/107 (20%)
leucine-rich repeat 103..126 CDD:275378 7/22 (32%)
LRR_4 126..165 CDD:289563 15/87 (17%)
leucine-rich repeat 127..150 CDD:275378 9/71 (13%)
leucine-rich repeat 151..174 CDD:275378 8/22 (36%)
leucine-rich repeat 175..187 CDD:275378 2/11 (18%)
LRRCT 183..234 CDD:214507 15/50 (30%)
EPTP 247..279 CDD:281697
EPTP 285..325 CDD:281697
EPTP 334..378 CDD:281697
EPTP 381..423 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.