Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122241.1 | Gene: | lgi1b / 654829 | ZFINID: | ZDB-GENE-060217-1 | Length: | 543 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 58/265 - (21%) |
---|---|---|---|
Similarity: | 97/265 - (36%) | Gaps: | 73/265 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 LLW----LLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEI 122
Fly 123 QLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELR 187
Fly 188 ELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGT 252
Fly 253 ITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT-----CESPPRLSGRAWDKLDVD 312
Fly 313 DFACV 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 28/156 (18%) |
leucine-rich repeat | 112..137 | CDD:275380 | 1/24 (4%) | ||
LRR_8 | 137..196 | CDD:290566 | 9/58 (16%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 184..245 | CDD:290566 | 18/60 (30%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 4/22 (18%) | ||
LRRCT | 267..316 | CDD:214507 | 14/53 (26%) | ||
IG_like | 328..428 | CDD:214653 | |||
Ig | 335..425 | CDD:143165 | |||
lgi1b | NP_001122241.1 | LRR_8 | 83..143 | CDD:290566 | 18/60 (30%) |
LRR_4 | 83..124 | CDD:289563 | 10/40 (25%) | ||
leucine-rich repeat | 85..108 | CDD:275378 | 6/22 (27%) | ||
LRR_4 | 107..147 | CDD:289563 | 13/40 (33%) | ||
leucine-rich repeat | 109..132 | CDD:275378 | 7/22 (32%) | ||
leucine-rich repeat | 133..156 | CDD:275378 | 4/23 (17%) | ||
leucine-rich repeat | 157..169 | CDD:275378 | 3/11 (27%) | ||
LRRCT | 165..213 | CDD:214507 | 14/53 (26%) | ||
EPTP | 217..258 | CDD:281697 | |||
EPTP | 263..304 | CDD:281697 | |||
EPTP | 309..355 | CDD:281697 | |||
EPTP | 358..400 | CDD:281697 | |||
EPTP | 405..447 | CDD:281697 | |||
EPTP | 450..491 | CDD:281697 | |||
EPTP | 496..536 | CDD:281697 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170574245 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |