DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lgi2a

DIOPT Version :10

Sequence 1:NP_523575.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001034730.1 Gene:lgi2a / 654827 ZFINID:ZDB-GENE-060217-2 Length:536 Species:Danio rerio


Alignment Length:287 Identity:62/287 - (21%)
Similarity:115/287 - (40%) Gaps:71/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLLW-LLCCCSQLGQLRA---ECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNE 121
            :::| ||...:.||....   :||:.|.|    .|||::|:.:  :::|                
Zfish     5 VIIWALLLYLAPLGNTAKKAFKCPSSCSC----SKESIICVGS--SYVP---------------- 47

  Fly   122 IQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSEL 186
             :.||:|..:.:                         ::|....::.:.:.|.:|||.|      
Zfish    48 -RYIPNDVSSLS-------------------------IVNGTFSEVKEAMFSHMPSLQL------ 80

  Fly   187 RELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSG 251
              |.|:.|.:..|.||||..:|.|..|.:.:.::...:..:|.||. .|..|.|..|.:..:...
Zfish    81 --LLLNSNALTTVRDDAFSGLPHLEYLFIENNKIETTSKYSFRGLR-DLTHLSLANNNIKALPRE 142

  Fly   252 TITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIP-SGIPPTCESPPRLSGRAWDKLDVDDFA 315
            ....|.||..|:|..|.:.|.|..:.|..|:...|.. |.:  .|..|..:.|:.     ::|.|
Zfish   143 LFIDLDSLIELDLRGNVFECDCRAKWLMMWLKSTNATVSDV--LCAGPEEMKGKR-----LNDMA 200

  Fly   316 CV-PQIVATD-TTAHGVEGRNITMSCY 340
            .: .:.::|| ...|.|...::::..:
Zfish   201 SLHNECISTDFIPLHSVPTESLSVDTF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_523575.1 LRR <98..>267 CDD:443914 33/168 (20%)
leucine-rich repeat 112..137 CDD:275380 3/24 (13%)
leucine-rich repeat 138..161 CDD:275380 0/22 (0%)
leucine-rich repeat 162..185 CDD:275380 5/22 (23%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..234 CDD:275380 5/23 (22%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 11/49 (22%)
Ig 331..428 CDD:472250 0/10 (0%)
Ig strand B 335..339 CDD:409562 0/3 (0%)
Ig strand C 348..352 CDD:409562
Ig strand E 394..398 CDD:409562
Ig strand F 408..413 CDD:409562
Ig strand G 421..424 CDD:409562
lgi2aNP_001034730.1 LRR_8 54..112 CDD:404697 17/90 (19%)
LRR_8 100..158 CDD:404697 15/58 (26%)
leucine-rich repeat 102..125 CDD:275378 5/23 (22%)
leucine-rich repeat 126..149 CDD:275378 5/22 (23%)
PCC 131..>206 CDD:188093 19/81 (23%)
leucine-rich repeat 150..162 CDD:275378 4/11 (36%)
EPTP 210..250 CDD:461033 3/18 (17%)
EPTP 257..295 CDD:461033
EPTP 302..347 CDD:461033
EPTP 351..392 CDD:461033
EPTP 398..439 CDD:461033
EPTP 443..483 CDD:461033
EPTP 490..529 CDD:461033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.