DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and Lrrc4

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001032413.1 Gene:Lrrc4 / 641521 RGDID:1560026 Length:652 Species:Rattus norvegicus


Alignment Length:685 Identity:168/685 - (24%)
Similarity:250/685 - (36%) Gaps:214/685 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LP-LHLHLLLWLLC----CCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQL 114
            || ::|...:|:||    ..:..|.  ..||:||.|..:..|  |:|....|:.:||.:.:.|:.
  Rat    18 LPVVYLTAQVWILCAAIAAAASAGP--QNCPSVCSCSNQFSK--VVCTRRGLSEVPQGIPSNTRY 78

  Fly   115 LDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLA 179
            |:|..|.||:|..|:|  ..|.:|:.:.|.|..:|.||..||..|.:|..|:|..|.|:.|||.|
  Rat    79 LNLMENNIQMIQADTF--RHLHHLEVLQLGRNAIRQIEVGAFNGLASLNTLELFDNWLTVIPSGA 141

  Fly   180 LYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDC-RLSHIAVRAFAGLES---------- 233
            ..::|:||||.|..|||..:|..||..||.|::|:|.:. :|.:|:..||.||.:          
  Rat   142 FEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCN 206

  Fly   234 -----------SLEWLKLDGNRLSEVRSGTITSLASL---------------------------- 259
                       .||.|::.||...|:|.|:...|:||                            
  Rat   207 IKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELN 271

  Fly   260 --HG------------------LELARNTWNCSCSLRPLRAWMLQQNIP--SGIPPTCESPPRLS 302
              |.                  |.|..|.|||.|.:..| ||.|::.||  |.....|.:|..:.
  Rat   272 LAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWL-AWWLREYIPTNSTCCGRCHAPMHMR 335

  Fly   303 GRAWDKLDVDDFAC-VPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGD 366
            ||...::|...|.| .|.|:......:..|.|...:.|...  |..:|||||.|..:.:      
  Rat   336 GRYLVEVDQASFQCSAPFIMDAPRDLNISEDRMAELKCRTP--PMSSVKWLLPNGTVLS------ 392

  Fly   367 GDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVS-- 429
             .:...||.:....|        ..|.|.:.::     |.|:|||...|.||...||..|.||  
  Rat   393 -HASRHPRISVLNDG--------TLNFSRVLLI-----DTGVYTCMVTNVAGNSNASAYLNVSSA 443

  Fly   430 ------------------------------------------------------RRPPEAP---- 436
                                                                  |.|.:.|    
  Rat   444 ELNTPNFSFFTTVTVETTEISPEDITRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPVPST 508

  Fly   437 -------------WGVRIILLGAVAALLLVGGSSFAAICLCSLQRRRKLRLWNSVPPVRRSESYE 488
                         .....|::|...|:.|:..:..  |....|::|.:.|  ::|...|..|..:
  Rat   509 DTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAML--IVFYKLRKRHQQR--STVTAARTVEIIQ 569

  Fly   489 KIEMTARTRPDLGGGASCGGGSATGAGLFHDAEEQGYLRAAHTPLNDNDAGQAAAIVNPSAGSAQ 553
            ..|       |:...||   .:||.|......|....|...|..:|.|       ...|:.|:..
  Rat   570 VDE-------DIPAAAS---AAATAAPSGVSGEGAVVLPTIHDHINYN-------TYKPAHGAHW 617

  Fly   554 RRN--GDYLH-----------VSTHCDDEEEDQQL 575
            ..|  |:.||           :.||..|:.::.|:
  Rat   618 TENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 65/226 (29%)
leucine-rich repeat 112..137 CDD:275380 10/24 (42%)
LRR_8 137..196 CDD:290566 25/58 (43%)
leucine-rich repeat 138..161 CDD:275380 9/22 (41%)
leucine-rich repeat 162..185 CDD:275380 9/22 (41%)
LRR_8 184..245 CDD:290566 28/82 (34%)
leucine-rich repeat 186..209 CDD:275380 12/22 (55%)
leucine-rich repeat 210..234 CDD:275380 9/45 (20%)
leucine-rich repeat 235..258 CDD:275380 9/22 (41%)
LRRCT 267..316 CDD:214507 18/50 (36%)
IG_like 328..428 CDD:214653 26/99 (26%)
Ig 335..425 CDD:143165 23/89 (26%)
Lrrc4NP_001032413.1 LRRNT 45..78 CDD:214470 12/34 (35%)
LRR_8 74..132 CDD:404697 22/59 (37%)
LRR 1 75..96 9/22 (41%)
leucine-rich repeat 76..99 CDD:275380 10/24 (42%)
PPP1R42 96..300 CDD:411060 56/203 (28%)
LRR 2 99..120 8/20 (40%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR 3 123..144 9/20 (45%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
LRR 4 147..168 11/20 (55%)
leucine-rich repeat 148..171 CDD:275380 12/22 (55%)
LRR 5 171..193 7/21 (33%)
leucine-rich repeat 172..196 CDD:275380 9/23 (39%)
LRR 6 196..217 0/20 (0%)
leucine-rich repeat 197..218 CDD:275380 0/20 (0%)
LRR 7 218..239 8/20 (40%)
leucine-rich repeat 219..242 CDD:275380 9/22 (41%)
LRR 8 242..263 2/20 (10%)
leucine-rich repeat 243..266 CDD:275380 1/22 (5%)
LRR 9 266..287 1/20 (5%)
leucine-rich repeat 267..288 CDD:275380 1/20 (5%)
LRRCT 299..350 CDD:214507 18/51 (35%)
IG_like 358..440 CDD:214653 26/103 (25%)
Ig strand B 369..373 CDD:409353 0/3 (0%)
Ig strand C 380..384 CDD:409353 2/3 (67%)
Ig strand E 406..410 CDD:409353 1/11 (9%)
Ig strand F 420..425 CDD:409353 3/4 (75%)
Ig strand G 433..436 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46071
orthoMCL 1 0.900 - - OOG6_104601
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.