| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001093513.1 | Gene: | flrt2 / 571972 | ZFINID: | ZDB-GENE-070705-267 | Length: | 662 | Species: | Danio rerio |
| Alignment Length: | 355 | Identity: | 94/355 - (26%) |
|---|---|---|---|
| Similarity: | 139/355 - (39%) | Gaps: | 109/355 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 LLLWLLCCCSQLGQLR--AECPAVCECKWKSGKESVLCLNANLTHIPQ----------------- 106
Fly 107 ----PLD----AGTQLLDLSGNEIQLIPDDSFATAQLLNLQ--------KVYLARCH----LRL- 150
Fly 151 --------IERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHV 207
Fly 208 P------------------------------------------------QLVKLELSDCRLSHIA 224
Fly 225 VRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPS 289
Fly 290 GIPP---TCESPPRLSGRAWDKLDVDDFAC 316 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 59/225 (26%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 4/24 (17%) | ||
| LRR_8 | 137..196 | CDD:290566 | 26/79 (33%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 11/43 (26%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 184..245 | CDD:290566 | 27/108 (25%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 11/70 (16%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 11/23 (48%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 267..316 | CDD:214507 | 18/51 (35%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| flrt2 | NP_001093513.1 | LRRNT | 36..62 | CDD:214470 | 9/29 (31%) |
| leucine-rich repeat | 45..65 | CDD:275378 | 5/19 (26%) | ||
| leucine-rich repeat | 66..89 | CDD:275378 | 2/22 (9%) | ||
| leucine-rich repeat | 90..110 | CDD:275380 | 4/19 (21%) | ||
| LRR_8 | 109..171 | CDD:290566 | 16/61 (26%) | ||
| leucine-rich repeat | 111..134 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | 114..310 | CDD:238064 | 54/199 (27%) | ||
| leucine-rich repeat | 135..160 | CDD:275380 | 6/24 (25%) | ||
| leucine-rich repeat | 161..181 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 182..242 | CDD:290566 | 11/59 (19%) | ||
| leucine-rich repeat | 182..205 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 206..231 | CDD:275380 | 0/24 (0%) | ||
| leucine-rich repeat | 232..253 | CDD:275380 | 0/20 (0%) | ||
| LRR_8 | 253..311 | CDD:290566 | 22/58 (38%) | ||
| leucine-rich repeat | 254..277 | CDD:275380 | 11/23 (48%) | ||
| leucine-rich repeat | 278..301 | CDD:275380 | 7/22 (32%) | ||
| TPKR_C2 | 310..361 | CDD:301599 | 19/53 (36%) | ||
| fn3 | 429..503 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||