DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lingo1a

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_005174327.1 Gene:lingo1a / 564943 ZFINID:ZDB-GENE-080327-16 Length:615 Species:Danio rerio


Alignment Length:614 Identity:135/614 - (21%)
Similarity:196/614 - (31%) Gaps:230/614 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSF------------- 130
            ||:.|||..:  :.||||....|..:|:.:.:.|:|||||.|.|:.|..|.|             
Zfish    35 CPSRCECNVQ--ERSVLCHRKKLMSVPEGIPSETRLLDLSKNRIKTINPDEFSAFPQLEELELNE 97

  Fly   131 ---------ATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNL--------------- 171
                     |...|..||.:.|....|:||:...|..|.||.:||:|:|.               
Zfish    98 NTISAIEPGAFNNLYGLQTLGLRSNKLKLIQLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNL 162

  Fly   172 ----------------------------------------------------------------- 171
                                                                             
Zfish   163 RSLEVGDNDLVFISHRAFHGLSSLEQLTLEKCNLTSVPTEAFTHLHSLVTLRLRNLNINSIRDYS 227

  Fly   172 ----------------------------------------LSAIPSLALYHVSELRELRLSGNPI 196
                                                    |::||.|||.|:..||.|.:|.|||
Zfish   228 FKRLYRLKVLEIANWPYLDTMTTNCLYGLNLTSLTITNANLTSIPYLALRHLVYLRFLNMSYNPI 292

  Fly   197 LRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHG 261
            ..:..:....:.:|.:|.|...|||.|...:|.|| :.|:.|.:..|.|:.:......|:.:|..
Zfish   293 QMIEGNRLHDLLRLQELYLVGGRLSVIEPYSFRGL-NYLKVLNVSSNFLTTLEESVFHSVGNLET 356

  Fly   262 LELARNTWNCSCSLRPL--RAWMLQQNIPSGIPPTCESPPRLSGRAW----DKLDVDDFAC---- 316
            |.|..|...|.|.|..:  |.|.|..|...   |||.||..:.|:.:    |.|..:.|.|    
Zfish   357 LALHDNPLACDCRLLWVFRRRWRLNFNRQQ---PTCSSPEFVQGKEFKDFPDILQPNYFTCRKSR 418

  Fly   317 ----VPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAA 377
                .||....|      ||..:...|..:|.|.|.:.||...:....:.               
Zfish   419 IRDRKPQQKFVD------EGTTVHFVCQADGDPTPVIMWLSPQKQFITMK--------------- 462

  Fly   378 ATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKVEA-----------------SVT 425
             |.||.|...:     ..|.:..|.:||.|.|.|.|.|..|...|                 :.|
Zfish   463 -TIGRLTVFPD-----GTLEVRYAQIQDNGTYGCIASNAGGNDTALAHLHVHSYSPDWPNQPNKT 521

  Fly   426 LA-VSRRPPE-----------APWGVRIILLGAVAALLLVGGSSFAAICLCSLQRRRKLRLWNSV 478
            || :|.:|.:           .|:.::.:::...     :|..||..:.|..|.   .|.||:. 
Zfish   522 LAFISNQPNDNSINETRATVPFPFDIKTLIIATT-----MGFISFLGVVLFCLV---LLFLWSR- 577

  Fly   479 PPVRRSESYEKIEMTARTRPDLGGGASCG 507
               .:..|...||:....|....|.:|.|
Zfish   578 ---GKGNSKHNIEIEYVPRKSDAGMSSSG 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 59/298 (20%)
leucine-rich repeat 112..137 CDD:275380 13/46 (28%)
LRR_8 137..196 CDD:290566 26/178 (15%)
leucine-rich repeat 138..161 CDD:275380 8/22 (36%)
leucine-rich repeat 162..185 CDD:275380 12/142 (8%)
LRR_8 184..245 CDD:290566 20/60 (33%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 10/23 (43%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 17/54 (31%)
IG_like 328..428 CDD:214653 26/117 (22%)
Ig 335..425 CDD:143165 21/106 (20%)
lingo1aXP_005174327.1 LRRNT 34..68 CDD:214470 12/34 (35%)
LRR_RI <55..231 CDD:238064 29/175 (17%)
leucine-rich repeat 66..89 CDD:275380 11/22 (50%)
LRR_8 88..148 CDD:290566 16/59 (27%)
leucine-rich repeat 90..113 CDD:275380 2/22 (9%)
leucine-rich repeat 114..137 CDD:275380 8/22 (36%)
LRR_8 136..196 CDD:290566 6/59 (10%)
leucine-rich repeat 138..185 CDD:275380 5/46 (11%)
LRR_8 184..241 CDD:290566 0/56 (0%)
leucine-rich repeat 186..209 CDD:275380 0/22 (0%)
leucine-rich repeat 210..257 CDD:275380 0/46 (0%)
leucine-rich repeat 234..256 CDD:275380 0/21 (0%)
LRR_8 257..316 CDD:290566 17/58 (29%)
leucine-rich repeat 258..281 CDD:275380 7/22 (32%)
leucine-rich repeat 282..305 CDD:275380 7/22 (32%)
LRR_8 305..364 CDD:290566 19/59 (32%)
leucine-rich repeat 306..329 CDD:275380 10/23 (43%)
leucine-rich repeat 330..350 CDD:275380 4/19 (21%)
TPKR_C2 362..>398 CDD:301599 13/38 (34%)
I-set 421..507 CDD:254352 26/112 (23%)
Ig 432..507 CDD:299845 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8422
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.