Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139054.1 | Gene: | lingo2b / 564052 | ZFINID: | ZDB-GENE-080723-57 | Length: | 607 | Species: | Danio rerio |
Alignment Length: | 530 | Identity: | 128/530 - (24%) |
---|---|---|---|
Similarity: | 182/530 - (34%) | Gaps: | 203/530 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 LPLHLHLLLWLLCCCSQLGQLRAE-CPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLS 118
Fly 119 GNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHV 183
Fly 184 SELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEV 248
Fly 249 RSGTITSLASLHGL-----------ELARNTWN-------------------------------- 270
Fly 271 ----------------------------------------------------------------- 270
Fly 271 -------------------------------------CSCSLRPLRAWMLQQNIP---SGIPPTC 295
Fly 296 ESPPRLSGRAWDKL---DVDDFA-CV-PQIVA-TDTTAHGVEGRNITMSCYVEGVPQPAVKWLLK 354
Fly 355 -NRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAG 418
Fly 419 KVEASVTLAV 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 60/167 (36%) |
leucine-rich repeat | 112..137 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 137..196 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 184..245 | CDD:290566 | 26/60 (43%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 14/23 (61%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 267..316 | CDD:214507 | 14/189 (7%) | ||
IG_like | 328..428 | CDD:214653 | 31/100 (31%) | ||
Ig | 335..425 | CDD:143165 | 26/90 (29%) | ||
lingo2b | NP_001139054.1 | LRRNT | 26..58 | CDD:214470 | 11/33 (33%) |
leucine-rich repeat | 37..60 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 59..116 | CDD:290566 | 18/58 (31%) | ||
leucine-rich repeat | 61..81 | CDD:275380 | 7/21 (33%) | ||
LRR_RI | <103..214 | CDD:238064 | 43/114 (38%) | ||
LRR_8 | 104..188 | CDD:290566 | 34/84 (40%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 130..153 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 154..177 | CDD:275380 | 14/23 (61%) | ||
leucine-rich repeat | 178..201 | CDD:275380 | 9/25 (36%) | ||
LRR_8 | 201..260 | CDD:290566 | 5/58 (9%) | ||
leucine-rich repeat | 202..225 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 226..271 | CDD:275380 | 0/44 (0%) | ||
LRR_8 | 272..330 | CDD:290566 | 0/57 (0%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 320..338 | CDD:275380 | 0/17 (0%) | ||
leucine-rich repeat | 344..356 | CDD:275378 | 0/11 (0%) | ||
LRRCT | 352..394 | CDD:214507 | 12/45 (27%) | ||
IG_like | 419..497 | CDD:214653 | 31/99 (31%) | ||
Ig | 422..497 | CDD:299845 | 30/96 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |